SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479431.Namu_3992 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479431.Namu_3992
Domain Number 1 Region: 402-541
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.81e-27
Family HD domain 0.032
Further Details:      
 
Domain Number 2 Region: 300-388
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000498
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 479431.Namu_3992
Sequence length 610
Comment (Nakamurella multipartita DSM 44233)
Sequence
MSDALVIALILALLVAVGAVVALARRKPVAPPPAVDEDSLRRLLDEAVSRSASEVKPAAE
PDLGRFALLSHEAQAAAEAADAVRRTAAEAAEELSVRTRRDAEQLRQDAQAEAQRTIAAA
RAQAAELRAGLENERTRIAGEATAALAQDRKELQEAEQRLRAATQALADEQHALVADRRR
IGSESSELASAKRALEAKAAALAEQEADLRKQAGALDQRERDLAAADAAREAELVRISGL
TVEAARAELLAGQEEAVRRDAAMMIRRIESEAQNSAKQRARAIVAEAIQRVASDQTAQTV
VAVVHLPADEVKGRIIGREGRNIRAFETVTGVNVIIDDTPEAVLLSCFDPVRREIGRITL
EMLIDDGRIHPHRIEEAFERARDEVDVLCRRAAEDAMLDVRITDLHPELVALIGRLKYRT
SYGQNVLGHLVETAHIARAMAAELGIDPTVVTRGAFLHDIGKALTHEVPGSHALIGADLA
RKYGESDEVVHCIEAHHDEVAPSTVEAVLTQAADACSGGRPGARRESLESYVQRLERIEA
IAGAKKGVEKVFAMQAGRELRVMVKPDIVDDVEAHILAREVAKQIEEELTYPGQVRVTVI
RESRATEIAR
Download sequence
Identical sequences C8XHI1
gi|258654117|ref|YP_003203273.1| 479431.Namu_3992 WP_015749109.1.85990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]