SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479432.Sros_2218 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479432.Sros_2218
Domain Number 1 Region: 297-449
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.86e-24
Family HD domain 0.032
Further Details:      
 
Domain Number 2 Region: 190-271
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000163
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 479432.Sros_2218
Sequence length 502
Comment (Streptosporangium roseum DSM 43021)
Sequence
MTGPSPEQEAEIQAALEEARLEAAEIRTRAQHDAEEVLRRSEAAVDAAAELRKEAEAESR
GLKYELKELRSDLERRENRLAEREQRLDEEARRQADRARKLAETETKLAGRREDLDRVAQ
ERKVILERVSGLTSDQARAELVREIENQAKREAALIVREIEGEARREGEKRATKIVTLAV
QRVATEQTAESVVSVLHLPGDEMKGRIIGREGRNIRAFESTTGVNLIIDDTPEAVLLSCF
DPVRRETARLTLEKLVLDGRIHPQRIEEAHERSKVEVQELCVRAGEDALVELGITEMHPE
LITLLGQLRYRTSYGQNVLGHLVESAHIAGIMAAELRLDPMLLKRCTVLHDIGKALTHEV
EGSHALIGAEIARRYGEHEDVVHAIEAHHNEVEVKTVEAVLTQAADAISGGRPGARRESL
EAYVKRLERLEEIATSYDGVDKVFAMQAGREIRVMVKPDSVDDIQAQVIARDVAKQVEEE
LTYPGQIRITVVRESRATEFAR
Download sequence
Identical sequences D2AY29
gi|271963747|ref|YP_003337943.1| 479432.Sros_2218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]