SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479433.Caci_0136 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479433.Caci_0136
Domain Number 1 Region: 386-472
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000879
Family Cadherin 0.043
Further Details:      
 
Weak hits

Sequence:  479433.Caci_0136
Domain Number - Region: 483-610
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0285
Family MAM domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 479433.Caci_0136
Sequence length 622
Comment (Catenulispora acidiphila DSM 44928)
Sequence
MKNTNTRRRAAAAGAAVATMAAGFGLLAATAQTAQAWEINPASCKHAPHSHKHGVQPTET
QTLCDRINAAGHAAPTGSETLSYGGGVDGIGVNSGKNQVYLVFYGSQWGTQTAGSNGVSS
FSGDPKGAAPAAQKMFKDIGTGGETWSADLTQWCDGPNVAAGATSCPSNAAFVPYQSGGV
LAGVWYDNSAASPAKASGHALGVEAVNAAAHFGNTTAASNRNAYYVILSPTGTNPDDYEN
PSTGYCAWHDYNGDTTLTGGAVASSYGDIAFSNQPYNIDAGQTCGTNFVNSGSAGTLDGY
TMTLGHEWHEMMSDKNPAGGWTNNTGSSYNGQENSDECAWLKPGTTGGAANVTLGSDTFA
EQASWSNDTNGCAMSHQILTHNGGGAVTVTQPAAQTSTVGSAVSLQIQASDSTSGQTLSY
TATGLPQGVAINSASGLISGTPTTAGSSSVTVTVKDTTGASGSATFGWTVNSTTGGGTVI
TNGGFENGSLSGWTTSGVTAATATGPHAGGYAAELGNLNPSSTSTIAQTFTAGAGNSRLA
FWYNVTCDDTVQYDWATATLKDNTTGTTKTVLAKTCTNPTSGWKQVTAAVTAGDSYTLTL
SNHDDNYAGDPTYTLYDDVAVS
Download sequence
Identical sequences C7QHF2
479433.Caci_0136 gi|256389368|ref|YP_003110932.1| WP_012784386.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]