SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479433.Caci_7876 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479433.Caci_7876
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.1e-46
Family Ribonuclease PH domain 1-like 0.000000177
Further Details:      
 
Domain Number 2 Region: 321-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-43
Family Ribonuclease PH domain 1-like 0.000000409
Further Details:      
 
Domain Number 3 Region: 152-259
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.42e-27
Family Ribonuclease PH domain 2-like 0.00000492
Further Details:      
 
Domain Number 4 Region: 474-573
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.17e-24
Family Ribonuclease PH domain 2-like 0.00000809
Further Details:      
 
Domain Number 5 Region: 575-688
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.17e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 6 Region: 264-344
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.22e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 479433.Caci_7876
Sequence length 737
Comment (Catenulispora acidiphila DSM 44928)
Sequence
MSEGVFTTEAVIDNGPFGQRTVRFETGRLARQAAGSVVAYLDEETMVLSATTASKSPKDS
LDFFPLTVDVEERMYAVGRIPGSFFRREGRPSEDAILTCRLIDRPLRPSFAKGLRNEVQV
VATIMALNPDHLYDVVAINAASASTQLAGLPFSGPIGGVRVALIQDRWVAFPTHTELADA
VFDMVVAGRTLEDGDVAIMMVEAEATSQTVSLVAGGSTAPTEEVVADGLEAAKPFIKALC
VAQQELASQAAKATAEFPRFLDYQDDVLEAVSATAKNELSNALTIAGKHEREEELDRVKA
LVVEKLAQQFEGREKEIGGAFRALTKKLVRERIIRDQVRIDGRGVRDIRPLSAEVEVVPR
VHGSALFERGETQILGITTLNMLRMEQQLDTLNPETRKRYMHNYNFPPYSTGETGRVGSP
KRREIGHGALAERALVPVLPTREEFPYAIRQVSEALSSNGSTSMGSVCASTMSLLNAGVP
LKAPVAGIAMGLVSAEIDGKTEYVALTDILGAEDAFGDMDFKVAGTKEFVTALQLDTKLD
GIPASVLAAALKQAKDARLHILDVMMEAIDVPDEMSEFAPRIISVKIPVDKIGEVIGPKG
KMINQIQEDTGAEITIEDDGTIYIGASNGAAAEAARVTINQIANPTMPEVGERYLGTVVK
TTTFGAFVSLMPGRDGLLHVSQLKKLAGGKRVENVEDVVKVGDKLQVEIAEIDSRGKLSL
IPVLPDEESKPAEAKAE
Download sequence
Identical sequences C7QFC2
WP_015796424.1.73754 gi|256396976|ref|YP_003118540.1| 479433.Caci_7876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]