SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479436.Vpar_0769 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479436.Vpar_0769
Domain Number 1 Region: 289-482
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-49
Family Ribonuclease PH domain 1-like 0.00001
Further Details:      
 
Domain Number 2 Region: 5-140
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.49e-45
Family Ribonuclease PH domain 1-like 0.0000192
Further Details:      
 
Domain Number 3 Region: 445-544
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.27e-30
Family Ribonuclease PH domain 2-like 0.0000875
Further Details:      
 
Domain Number 4 Region: 141-230
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.32e-29
Family Ribonuclease PH domain 2-like 0.00093
Further Details:      
 
Domain Number 5 Region: 549-635
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.71e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 6 Region: 615-687
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.98e-20
Family Cold shock DNA-binding domain-like 0.00027
Further Details:      
 
Domain Number 7 Region: 236-315
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 5.49e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 479436.Vpar_0769
Sequence length 689
Comment (Veillonella parvula DSM 2008)
Sequence
MEQFQMDLAGRTLTIETGELAKQAGGAVMVGYGDTRVLVTATGSKEAKDIDFFPLTVDYE
EKMYAVGRLPGGFIKREARPPESAILNSRLIDRPIRPLFNKGVRNEVHVVATVMSVDQDC
DPAICGMIGASAALSISDVPWNGPIAGVRMGRINGEFVVNPTKAQLEETDLNIVVAGTKD
AILMVEGGAEEVPEDIILEVIMAAHEEIKKIVAFQEDMTAKVGKEKRVFECKDVPVEISD
AVRAYGHDKLDAAVRCADKQQRDAQENEVRADVLAHFEEIYPDNLADVNKAFDAMTKEIV
RHMITVEKIRPDGRQLDEVRPISCRTGVLPRTHGSGLFTRGQTQVLNVITVAPLSEKQTI
DGLGVETEKRYIHHYNFPSFSVGETRSSRGPGRREIGHGALAERALVPVIPSEEDFPYAL
RLVSEVLESNGSSSMASVCGSTLSLMDAGVPIKAPVAGIAMGLVTQGEHYTILTDIQGME
DALGDMDFKVAGTAKGVTAIQMDIKISGLSREILQEALEQAHKGRMHIMGIMLDTIAEPR
QQMSQYAPRIITMKIDPDKIRDVIGSGGKVIRSIIEETGAKIDIEDDGTVFIASVEQEGA
AKAQEIITNLTKEVEVGEVYLGKVTRLMAFGAFVEVLPGKEGLVHISKLAKERVENVEDV
VSVGDEIMVKVIEIDKQGRVNLSRKDCLK
Download sequence
Identical sequences D1BM43
WP_012864243.1.68909 gi|269797830|ref|YP_003311730.1| 479436.Vpar_0769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]