SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 480119.AB57_0439 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  480119.AB57_0439
Domain Number 1 Region: 299-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.1e-45
Family Ribonuclease PH domain 1-like 0.0000175
Further Details:      
 
Domain Number 2 Region: 3-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-43
Family Ribonuclease PH domain 1-like 0.0000514
Further Details:      
 
Domain Number 3 Region: 146-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.77e-30
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 4 Region: 452-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.38e-28
Family Ribonuclease PH domain 2-like 0.00016
Further Details:      
 
Domain Number 5 Region: 558-642
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.55e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 6 Region: 622-695
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.64e-20
Family Cold shock DNA-binding domain-like 0.00036
Further Details:      
 
Domain Number 7 Region: 240-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 9.68e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 480119.AB57_0439
Sequence length 697
Comment (Acinetobacter baumannii AB0057)
Sequence
MSMFNIVRKEFQFGQHQVVLETGRVARQANTVLITMGGVTVLVAVVAAPTAKAGQDFFPL
TVNYQEKQYAAGRIPGGYGKREGRASEAETLISRLIDRPIRPLFPEGYYNEIQVTATVVS
SDKTMEADIAAMLGTSAALAIAGTPFRGPIGAARVGLINGEYVLNPNFEQMAQSDLDLVV
AGTESAVLMVESEAKELSEDQMLGAVLFGHDEMQIAIQAINEFAAAAGAKPSDWVAPAHN
EELRAKLKEAFEAKISEAYTIAVKQDRYAALDALHAEAVAQFVPEEDVDGIADEVDYLFE
DLKYRTVRDNILSGKPRIDGRDTKTVRALDVQVGVLERAHGSALFTRGETQALVTTTLGN
TRDALMVDTLAGTKTDNFMLHYNFPAYSVGETGRESGPKRREIGHGRLARRGVQAVLPAA
DRFPYVIRIVSDITESNGSSSMASVCGASLSLMDAGVPLKAPVAGIAMGLVKEGERFAVL
SDILGDEDHLGDMDFKVAGSANGITALQMDIKIEGITEEIMEVALNQAFAGRMHILNEMN
KVISRARPEISMHAPTFEVITINPDKIRDVIGKGGATIRQITEETKAAIDIEDNGTVRVF
GETKAAAKAAIAKIQAITAEVEPGKIYDGKVIRIVEFGAFVNIMPGTDGLLHISQISNER
IANVTDVLKEGQEVKVQVQDVDNRGRIKLTMKDIEQA
Download sequence
Identical sequences A0A009G5V4 A0A009HWG2 A0A009K3N0 A0A009PH41 A0A009S431 A0A009TQD1 A0A062DR93 A0A062EZP4 A0A062FHM7 A0A062FLS3 A0A062IQ02 A0A062IVR6 A0A062MVI0 A0A0E1PUS7 A0A0J1A624 A0A0R1B6G0 A0A158LRH1 A0A171EHA8 A0A1C4HE07 A3M1M7 B0VEA3 B2I2Q0 B7H0Z1 B7I3U1 D0CAU8 G2JF28 L9P8C4 N8ZAV9 N9GD89 N9J737 N9KL21 S3U6J0 V5VH92
gi|523529520|ref|YP_008215547.1| gi|565639713|ref|YP_008891956.1| gi|169797384|ref|YP_001715177.1| gi|469820515|ref|YP_007594885.1| HMPREF0010_01878T0 gi|384141647|ref|YP_005524357.1| gi|523521803|ref|YP_008207882.1| gi|387125393|ref|YP_006291275.1| gi|523525716|ref|YP_008211747.1| gi|184156693|ref|YP_001845032.1| 405416.ACICU_00373 480119.AB57_0439 509173.ABAYE3414 557600.ABBFA_003175 gi|407931298|ref|YP_006846941.1| gi|213155801|ref|YP_002317846.1| gi|215484824|ref|YP_002327059.1| WP_000061670.1.100006 WP_000061670.1.100119 WP_000061670.1.100121 WP_000061670.1.100124 WP_000061670.1.100136 WP_000061670.1.100152 WP_000061670.1.100157 WP_000061670.1.100211 WP_000061670.1.100222 WP_000061670.1.100225 WP_000061670.1.100238 WP_000061670.1.100259 WP_000061670.1.100290 WP_000061670.1.1003 WP_000061670.1.100380 WP_000061670.1.100406 WP_000061670.1.100454 WP_000061670.1.100567 WP_000061670.1.100568 WP_000061670.1.10058 WP_000061670.1.100616 WP_000061670.1.100656 WP_000061670.1.100849 WP_000061670.1.100864 WP_000061670.1.100957 WP_000061670.1.100971 WP_000061670.1.101001 WP_000061670.1.101005 WP_000061670.1.101012 WP_000061670.1.101037 WP_000061670.1.101069 WP_000061670.1.101100 WP_000061670.1.101243 WP_000061670.1.101254 WP_000061670.1.101258 WP_000061670.1.101276 WP_000061670.1.101338 WP_000061670.1.10136 WP_000061670.1.101389 WP_000061670.1.1014 WP_000061670.1.101409 WP_000061670.1.101413 WP_000061670.1.10147 WP_000061670.1.101515 WP_000061670.1.101574 WP_000061670.1.101742 WP_000061670.1.101810 WP_000061670.1.101812 WP_000061670.1.101850 WP_000061670.1.101885 WP_000061670.1.101910 WP_000061670.1.101976 WP_000061670.1.101995 WP_000061670.1.102023 WP_000061670.1.102025 WP_000061670.1.102081 WP_000061670.1.102110 WP_000061670.1.10256 WP_000061670.1.10328 WP_000061670.1.10375 WP_000061670.1.10403 WP_000061670.1.10466 WP_000061670.1.10512 WP_000061670.1.10649 WP_000061670.1.1065 WP_000061670.1.10725 WP_000061670.1.10768 WP_000061670.1.10777 WP_000061670.1.1080 WP_000061670.1.10832 WP_000061670.1.10838 WP_000061670.1.10852 WP_000061670.1.10909 WP_000061670.1.11003 WP_000061670.1.1101 WP_000061670.1.11016 WP_000061670.1.11019 WP_000061670.1.11090 WP_000061670.1.11135 WP_000061670.1.11203 WP_000061670.1.11206 WP_000061670.1.11305 WP_000061670.1.11307 WP_000061670.1.11308 WP_000061670.1.11374 WP_000061670.1.1138 WP_000061670.1.1155 WP_000061670.1.11698 WP_000061670.1.11724 WP_000061670.1.11766 WP_000061670.1.11813 WP_000061670.1.11910 WP_000061670.1.11923 WP_000061670.1.11924 WP_000061670.1.11925 WP_000061670.1.11926 WP_000061670.1.1194 WP_000061670.1.1195 WP_000061670.1.11977 WP_000061670.1.11989 WP_000061670.1.12109 WP_000061670.1.1216 WP_000061670.1.12250 WP_000061670.1.12322 WP_000061670.1.12358 WP_000061670.1.12414 WP_000061670.1.12477 WP_000061670.1.12529 WP_000061670.1.12617 WP_000061670.1.12638 WP_000061670.1.1270 WP_000061670.1.12702 WP_000061670.1.12703 WP_000061670.1.12796 WP_000061670.1.12818 WP_000061670.1.1283 WP_000061670.1.12837 WP_000061670.1.12912 WP_000061670.1.12974 WP_000061670.1.13047 WP_000061670.1.13078 WP_000061670.1.13109 WP_000061670.1.13124 WP_000061670.1.13137 WP_000061670.1.1317 WP_000061670.1.13195 WP_000061670.1.13220 WP_000061670.1.13236 WP_000061670.1.13263 WP_000061670.1.13480 WP_000061670.1.13485 WP_000061670.1.13516 WP_000061670.1.13521 WP_000061670.1.13596 WP_000061670.1.13616 WP_000061670.1.13635 WP_000061670.1.13651 WP_000061670.1.13675 WP_000061670.1.13699 WP_000061670.1.13761 WP_000061670.1.13788 WP_000061670.1.13821 WP_000061670.1.13850 WP_000061670.1.13871 WP_000061670.1.13894 WP_000061670.1.1390 WP_000061670.1.13916 WP_000061670.1.1396 WP_000061670.1.14020 WP_000061670.1.1411 WP_000061670.1.14271 WP_000061670.1.14293 WP_000061670.1.14354 WP_000061670.1.14357 WP_000061670.1.14385 WP_000061670.1.14392 WP_000061670.1.14479 WP_000061670.1.14515 WP_000061670.1.14637 WP_000061670.1.14650 WP_000061670.1.14700 WP_000061670.1.14756 WP_000061670.1.14801 WP_000061670.1.14829 WP_000061670.1.14853 WP_000061670.1.14854 WP_000061670.1.14909 WP_000061670.1.14915 WP_000061670.1.14939 WP_000061670.1.15066 WP_000061670.1.15105 WP_000061670.1.15152 WP_000061670.1.15159 WP_000061670.1.15166 WP_000061670.1.15289 WP_000061670.1.15383 WP_000061670.1.15428 WP_000061670.1.15462 WP_000061670.1.15465 WP_000061670.1.15497 WP_000061670.1.15651 WP_000061670.1.15653 WP_000061670.1.15656 WP_000061670.1.15695 WP_000061670.1.15713 WP_000061670.1.15736 WP_000061670.1.15778 WP_000061670.1.15793 WP_000061670.1.15821 WP_000061670.1.15947 WP_000061670.1.16011 WP_000061670.1.16082 WP_000061670.1.16092 WP_000061670.1.16178 WP_000061670.1.16202 WP_000061670.1.16288 WP_000061670.1.16325 WP_000061670.1.16343 WP_000061670.1.16371 WP_000061670.1.1639 WP_000061670.1.16398 WP_000061670.1.16411 WP_000061670.1.16434 WP_000061670.1.16510 WP_000061670.1.1656 WP_000061670.1.16576 WP_000061670.1.16578 WP_000061670.1.16579 WP_000061670.1.1658 WP_000061670.1.16607 WP_000061670.1.16610 WP_000061670.1.16699 WP_000061670.1.16701 WP_000061670.1.16717 WP_000061670.1.16760 WP_000061670.1.16787 WP_000061670.1.16850 WP_000061670.1.16864 WP_000061670.1.16993 WP_000061670.1.17002 WP_000061670.1.17021 WP_000061670.1.17097 WP_000061670.1.17244 WP_000061670.1.17394 WP_000061670.1.17414 WP_000061670.1.17433 WP_000061670.1.17468 WP_000061670.1.17492 WP_000061670.1.1753 WP_000061670.1.17616 WP_000061670.1.17632 WP_000061670.1.17646 WP_000061670.1.17664 WP_000061670.1.17752 WP_000061670.1.17781 WP_000061670.1.17999 WP_000061670.1.18082 WP_000061670.1.18091 WP_000061670.1.18238 WP_000061670.1.18246 WP_000061670.1.18293 WP_000061670.1.18302 WP_000061670.1.18325 WP_000061670.1.18385 WP_000061670.1.18499 WP_000061670.1.18546 WP_000061670.1.1863 WP_000061670.1.18755 WP_000061670.1.18887 WP_000061670.1.1893 WP_000061670.1.19092 WP_000061670.1.1910 WP_000061670.1.19120 WP_000061670.1.19131 WP_000061670.1.1916 WP_000061670.1.19168 WP_000061670.1.19292 WP_000061670.1.19339 WP_000061670.1.19396 WP_000061670.1.19475 WP_000061670.1.19531 WP_000061670.1.19617 WP_000061670.1.19670 WP_000061670.1.19750 WP_000061670.1.19826 WP_000061670.1.1984 WP_000061670.1.19877 WP_000061670.1.1995 WP_000061670.1.20044 WP_000061670.1.20066 WP_000061670.1.20120 WP_000061670.1.20127 WP_000061670.1.20172 WP_000061670.1.20176 WP_000061670.1.20194 WP_000061670.1.20198 WP_000061670.1.20306 WP_000061670.1.2033 WP_000061670.1.20359 WP_000061670.1.2039 WP_000061670.1.20444 WP_000061670.1.20532 WP_000061670.1.20534 WP_000061670.1.20541 WP_000061670.1.20571 WP_000061670.1.20656 WP_000061670.1.20743 WP_000061670.1.20748 WP_000061670.1.20755 WP_000061670.1.20807 WP_000061670.1.20816 WP_000061670.1.20817 WP_000061670.1.20830 WP_000061670.1.20889 WP_000061670.1.20948 WP_000061670.1.20987 WP_000061670.1.20998 WP_000061670.1.21032 WP_000061670.1.21112 WP_000061670.1.21117 WP_000061670.1.21167 WP_000061670.1.21264 WP_000061670.1.21337 WP_000061670.1.21342 WP_000061670.1.21462 WP_000061670.1.21484 WP_000061670.1.21546 WP_000061670.1.21554 WP_000061670.1.21644 WP_000061670.1.21662 WP_000061670.1.21689 WP_000061670.1.21738 WP_000061670.1.21747 WP_000061670.1.21798 WP_000061670.1.21810 WP_000061670.1.21939 WP_000061670.1.22047 WP_000061670.1.22053 WP_000061670.1.22073 WP_000061670.1.22104 WP_000061670.1.22108 WP_000061670.1.2215 WP_000061670.1.22209 WP_000061670.1.22216 WP_000061670.1.22286 WP_000061670.1.22301 WP_000061670.1.22349 WP_000061670.1.22396 WP_000061670.1.22452 WP_000061670.1.22469 WP_000061670.1.22515 WP_000061670.1.22529 WP_000061670.1.22586 WP_000061670.1.22687 WP_000061670.1.22793 WP_000061670.1.22847 WP_000061670.1.23023 WP_000061670.1.23141 WP_000061670.1.23173 WP_000061670.1.23176 WP_000061670.1.23188 WP_000061670.1.23243 WP_000061670.1.23328 WP_000061670.1.23401 WP_000061670.1.23595 WP_000061670.1.23596 WP_000061670.1.23636 WP_000061670.1.23651 WP_000061670.1.23669 WP_000061670.1.23674 WP_000061670.1.23771 WP_000061670.1.23821 WP_000061670.1.2386 WP_000061670.1.23975 WP_000061670.1.23997 WP_000061670.1.24015 WP_000061670.1.24041 WP_000061670.1.24097 WP_000061670.1.24105 WP_000061670.1.24152 WP_000061670.1.24178 WP_000061670.1.24260 WP_000061670.1.24292 WP_000061670.1.24358 WP_000061670.1.24373 WP_000061670.1.24449 WP_000061670.1.2445 WP_000061670.1.24545 WP_000061670.1.24611 WP_000061670.1.24621 WP_000061670.1.24706 WP_000061670.1.24740 WP_000061670.1.24744 WP_000061670.1.2475 WP_000061670.1.24750 WP_000061670.1.24846 WP_000061670.1.24916 WP_000061670.1.24924 WP_000061670.1.24927 WP_000061670.1.25055 WP_000061670.1.25091 WP_000061670.1.25131 WP_000061670.1.25143 WP_000061670.1.25263 WP_000061670.1.25292 WP_000061670.1.25478 WP_000061670.1.25519 WP_000061670.1.25524 WP_000061670.1.25560 WP_000061670.1.25588 WP_000061670.1.2559 WP_000061670.1.2561 WP_000061670.1.25638 WP_000061670.1.25723 WP_000061670.1.25810 WP_000061670.1.2585 WP_000061670.1.25850 WP_000061670.1.25971 WP_000061670.1.26181 WP_000061670.1.26204 WP_000061670.1.26215 WP_000061670.1.2626 WP_000061670.1.26352 WP_000061670.1.2641 WP_000061670.1.26425 WP_000061670.1.26436 WP_000061670.1.26472 WP_000061670.1.26504 WP_000061670.1.26528 WP_000061670.1.26647 WP_000061670.1.26669 WP_000061670.1.26678 WP_000061670.1.26701 WP_000061670.1.26715 WP_000061670.1.26744 WP_000061670.1.26831 WP_000061670.1.26946 WP_000061670.1.27059 WP_000061670.1.27109 WP_000061670.1.27156 WP_000061670.1.27176 WP_000061670.1.2722 WP_000061670.1.27220 WP_000061670.1.27265 WP_000061670.1.27270 WP_000061670.1.273 WP_000061670.1.2730 WP_000061670.1.27346 WP_000061670.1.2736 WP_000061670.1.2738 WP_000061670.1.27506 WP_000061670.1.27509 WP_000061670.1.27531 WP_000061670.1.2762 WP_000061670.1.27623 WP_000061670.1.2769 WP_000061670.1.27704 WP_000061670.1.27731 WP_000061670.1.27737 WP_000061670.1.27801 WP_000061670.1.27840 WP_000061670.1.27845 WP_000061670.1.27852 WP_000061670.1.27934 WP_000061670.1.27983 WP_000061670.1.28048 WP_000061670.1.2810 WP_000061670.1.28101 WP_000061670.1.28141 WP_000061670.1.28188 WP_000061670.1.28204 WP_000061670.1.28234 WP_000061670.1.28236 WP_000061670.1.28246 WP_000061670.1.28320 WP_000061670.1.28385 WP_000061670.1.28405 WP_000061670.1.28411 WP_000061670.1.28420 WP_000061670.1.28456 WP_000061670.1.28507 WP_000061670.1.28513 WP_000061670.1.28581 WP_000061670.1.28601 WP_000061670.1.28677 WP_000061670.1.28689 WP_000061670.1.28774 WP_000061670.1.28778 WP_000061670.1.2884 WP_000061670.1.28881 WP_000061670.1.28883 WP_000061670.1.28898 WP_000061670.1.28929 WP_000061670.1.28937 WP_000061670.1.28988 WP_000061670.1.29034 WP_000061670.1.29047 WP_000061670.1.29074 WP_000061670.1.29117 WP_000061670.1.29123 WP_000061670.1.29216 WP_000061670.1.29229 WP_000061670.1.29347 WP_000061670.1.29362 WP_000061670.1.29434 WP_000061670.1.29455 WP_000061670.1.29461 WP_000061670.1.29552 WP_000061670.1.29589 WP_000061670.1.29672 WP_000061670.1.29779 WP_000061670.1.2979 WP_000061670.1.29806 WP_000061670.1.29817 WP_000061670.1.29824 WP_000061670.1.29897 WP_000061670.1.29955 WP_000061670.1.30026 WP_000061670.1.30068 WP_000061670.1.30083 WP_000061670.1.30161 WP_000061670.1.30173 WP_000061670.1.30309 WP_000061670.1.30407 WP_000061670.1.30466 WP_000061670.1.30490 WP_000061670.1.30498 WP_000061670.1.30597 WP_000061670.1.30611 WP_000061670.1.30667 WP_000061670.1.30673 WP_000061670.1.30739 WP_000061670.1.3075 WP_000061670.1.30776 WP_000061670.1.30856 WP_000061670.1.30932 WP_000061670.1.30969 WP_000061670.1.30978 WP_000061670.1.30996 WP_000061670.1.31121 WP_000061670.1.31141 WP_000061670.1.3116 WP_000061670.1.31187 WP_000061670.1.31312 WP_000061670.1.31328 WP_000061670.1.31345 WP_000061670.1.31430 WP_000061670.1.3144 WP_000061670.1.3162 WP_000061670.1.3163 WP_000061670.1.31729 WP_000061670.1.31810 WP_000061670.1.31834 WP_000061670.1.31917 WP_000061670.1.3198 WP_000061670.1.31980 WP_000061670.1.32028 WP_000061670.1.32065 WP_000061670.1.32129 WP_000061670.1.32223 WP_000061670.1.3225 WP_000061670.1.32257 WP_000061670.1.32272 WP_000061670.1.32304 WP_000061670.1.32374 WP_000061670.1.32386 WP_000061670.1.32430 WP_000061670.1.32487 WP_000061670.1.32512 WP_000061670.1.32532 WP_000061670.1.32579 WP_000061670.1.32682 WP_000061670.1.32773 WP_000061670.1.3280 WP_000061670.1.32830 WP_000061670.1.32845 WP_000061670.1.32847 WP_000061670.1.32956 WP_000061670.1.32983 WP_000061670.1.3303 WP_000061670.1.33104 WP_000061670.1.33120 WP_000061670.1.33154 WP_000061670.1.33198 WP_000061670.1.33262 WP_000061670.1.33308 WP_000061670.1.33370 WP_000061670.1.33386 WP_000061670.1.33423 WP_000061670.1.33447 WP_000061670.1.3346 WP_000061670.1.33495 WP_000061670.1.33541 WP_000061670.1.33558 WP_000061670.1.33684 WP_000061670.1.33706 WP_000061670.1.33714 WP_000061670.1.33759 WP_000061670.1.33773 WP_000061670.1.33777 WP_000061670.1.33805 WP_000061670.1.33869 WP_000061670.1.33871 WP_000061670.1.33902 WP_000061670.1.33929 WP_000061670.1.33931 WP_000061670.1.33962 WP_000061670.1.33978 WP_000061670.1.33999 WP_000061670.1.34027 WP_000061670.1.34045 WP_000061670.1.34049 WP_000061670.1.34077 WP_000061670.1.34207 WP_000061670.1.34313 WP_000061670.1.34394 WP_000061670.1.34577 WP_000061670.1.34618 WP_000061670.1.34642 WP_000061670.1.34657 WP_000061670.1.34789 WP_000061670.1.34859 WP_000061670.1.34917 WP_000061670.1.34986 WP_000061670.1.35000 WP_000061670.1.35018 WP_000061670.1.35046 WP_000061670.1.35081 WP_000061670.1.35199 WP_000061670.1.35250 WP_000061670.1.35273 WP_000061670.1.35291 WP_000061670.1.35327 WP_000061670.1.35337 WP_000061670.1.3535 WP_000061670.1.35434 WP_000061670.1.35436 WP_000061670.1.35461 WP_000061670.1.35479 WP_000061670.1.35558 WP_000061670.1.35565 WP_000061670.1.35588 WP_000061670.1.35601 WP_000061670.1.35663 WP_000061670.1.3567 WP_000061670.1.35715 WP_000061670.1.35717 WP_000061670.1.35728 WP_000061670.1.35758 WP_000061670.1.35761 WP_000061670.1.35828 WP_000061670.1.35883 WP_000061670.1.35912 WP_000061670.1.36030 WP_000061670.1.36110 WP_000061670.1.36122 WP_000061670.1.3622 WP_000061670.1.36289 WP_000061670.1.36327 WP_000061670.1.36355 WP_000061670.1.36358 WP_000061670.1.36359 WP_000061670.1.36381 WP_000061670.1.36418 WP_000061670.1.36517 WP_000061670.1.36549 WP_000061670.1.36569 WP_000061670.1.36694 WP_000061670.1.36714 WP_000061670.1.36735 WP_000061670.1.36866 WP_000061670.1.36869 WP_000061670.1.36882 WP_000061670.1.3689 WP_000061670.1.36909 WP_000061670.1.36938 WP_000061670.1.37007 WP_000061670.1.3712 WP_000061670.1.37180 WP_000061670.1.3720 WP_000061670.1.37212 WP_000061670.1.37215 WP_000061670.1.37345 WP_000061670.1.37386 WP_000061670.1.37406 WP_000061670.1.37437 WP_000061670.1.3755 WP_000061670.1.37553 WP_000061670.1.3758 WP_000061670.1.37603 WP_000061670.1.37607 WP_000061670.1.37680 WP_000061670.1.37695 WP_000061670.1.37729 WP_000061670.1.37803 WP_000061670.1.37807 WP_000061670.1.37893 WP_000061670.1.37963 WP_000061670.1.37982 WP_000061670.1.38009 WP_000061670.1.38122 WP_000061670.1.38249 WP_000061670.1.38320 WP_000061670.1.3837 WP_000061670.1.3843 WP_000061670.1.3856 WP_000061670.1.3861 WP_000061670.1.38628 WP_000061670.1.38689 WP_000061670.1.38696 WP_000061670.1.38701 WP_000061670.1.38732 WP_000061670.1.38748 WP_000061670.1.38758 WP_000061670.1.38759 WP_000061670.1.38779 WP_000061670.1.38901 WP_000061670.1.38964 WP_000061670.1.39019 WP_000061670.1.39036 WP_000061670.1.39159 WP_000061670.1.39353 WP_000061670.1.39399 WP_000061670.1.39517 WP_000061670.1.39598 WP_000061670.1.39680 WP_000061670.1.39688 WP_000061670.1.397 WP_000061670.1.3974 WP_000061670.1.39799 WP_000061670.1.39901 WP_000061670.1.39911 WP_000061670.1.39927 WP_000061670.1.39928 WP_000061670.1.40199 WP_000061670.1.40200 WP_000061670.1.40225 WP_000061670.1.40233 WP_000061670.1.4029 WP_000061670.1.40297 WP_000061670.1.40332 WP_000061670.1.40431 WP_000061670.1.4047 WP_000061670.1.40490 WP_000061670.1.40497 WP_000061670.1.40547 WP_000061670.1.40552 WP_000061670.1.40559 WP_000061670.1.40645 WP_000061670.1.40679 WP_000061670.1.40721 WP_000061670.1.40832 WP_000061670.1.40836 WP_000061670.1.40845 WP_000061670.1.4086 WP_000061670.1.40864 WP_000061670.1.40947 WP_000061670.1.41029 WP_000061670.1.41059 WP_000061670.1.4110 WP_000061670.1.41201 WP_000061670.1.41266 WP_000061670.1.41395 WP_000061670.1.41425 WP_000061670.1.41507 WP_000061670.1.41546 WP_000061670.1.4164 WP_000061670.1.41707 WP_000061670.1.41710 WP_000061670.1.41720 WP_000061670.1.41738 WP_000061670.1.41777 WP_000061670.1.41838 WP_000061670.1.41878 WP_000061670.1.4191 WP_000061670.1.41922 WP_000061670.1.41934 WP_000061670.1.41936 WP_000061670.1.42011 WP_000061670.1.42080 WP_000061670.1.42143 WP_000061670.1.42172 WP_000061670.1.42253 WP_000061670.1.42289 WP_000061670.1.42351 WP_000061670.1.42377 WP_000061670.1.42401 WP_000061670.1.42484 WP_000061670.1.4253 WP_000061670.1.42531 WP_000061670.1.42561 WP_000061670.1.42571 WP_000061670.1.42581 WP_000061670.1.42708 WP_000061670.1.42721 WP_000061670.1.42765 WP_000061670.1.4277 WP_000061670.1.42773 WP_000061670.1.42824 WP_000061670.1.42888 WP_000061670.1.42928 WP_000061670.1.42961 WP_000061670.1.43011 WP_000061670.1.43028 WP_000061670.1.43088 WP_000061670.1.43094 WP_000061670.1.431 WP_000061670.1.4311 WP_000061670.1.43175 WP_000061670.1.43194 WP_000061670.1.43203 WP_000061670.1.43227 WP_000061670.1.43340 WP_000061670.1.43380 WP_000061670.1.43439 WP_000061670.1.43641 WP_000061670.1.43645 WP_000061670.1.43672 WP_000061670.1.43751 WP_000061670.1.43755 WP_000061670.1.43759 WP_000061670.1.43761 WP_000061670.1.43766 WP_000061670.1.43891 WP_000061670.1.43978 WP_000061670.1.44009 WP_000061670.1.44052 WP_000061670.1.44058 WP_000061670.1.44244 WP_000061670.1.4426 WP_000061670.1.44275 WP_000061670.1.443 WP_000061670.1.44342 WP_000061670.1.44370 WP_000061670.1.44372 WP_000061670.1.44385 WP_000061670.1.44407 WP_000061670.1.44419 WP_000061670.1.44538 WP_000061670.1.44613 WP_000061670.1.44664 WP_000061670.1.44684 WP_000061670.1.44770 WP_000061670.1.44809 WP_000061670.1.44816 WP_000061670.1.4484 WP_000061670.1.44886 WP_000061670.1.44926 WP_000061670.1.44929 WP_000061670.1.44944 WP_000061670.1.44964 WP_000061670.1.44974 WP_000061670.1.44991 WP_000061670.1.45149 WP_000061670.1.45212 WP_000061670.1.45233 WP_000061670.1.45239 WP_000061670.1.45291 WP_000061670.1.45307 WP_000061670.1.45350 WP_000061670.1.4537 WP_000061670.1.45399 WP_000061670.1.45418 WP_000061670.1.45457 WP_000061670.1.4548 WP_000061670.1.45517 WP_000061670.1.45587 WP_000061670.1.45608 WP_000061670.1.45637 WP_000061670.1.45647 WP_000061670.1.45675 WP_000061670.1.45761 WP_000061670.1.45839 WP_000061670.1.45916 WP_000061670.1.45966 WP_000061670.1.46038 WP_000061670.1.46080 WP_000061670.1.46108 WP_000061670.1.46114 WP_000061670.1.46126 WP_000061670.1.46138 WP_000061670.1.46194 WP_000061670.1.46209 WP_000061670.1.46224 WP_000061670.1.46246 WP_000061670.1.46255 WP_000061670.1.46258 WP_000061670.1.46337 WP_000061670.1.46338 WP_000061670.1.46385 WP_000061670.1.46392 WP_000061670.1.46413 WP_000061670.1.46417 WP_000061670.1.46474 WP_000061670.1.4648 WP_000061670.1.46493 WP_000061670.1.46518 WP_000061670.1.46577 WP_000061670.1.46645 WP_000061670.1.46739 WP_000061670.1.46774 WP_000061670.1.46827 WP_000061670.1.4683 WP_000061670.1.46850 WP_000061670.1.46887 WP_000061670.1.46896 WP_000061670.1.46918 WP_000061670.1.46950 WP_000061670.1.46959 WP_000061670.1.47070 WP_000061670.1.47141 WP_000061670.1.47219 WP_000061670.1.47241 WP_000061670.1.47298 WP_000061670.1.4733 WP_000061670.1.47388 WP_000061670.1.47436 WP_000061670.1.47475 WP_000061670.1.47515 WP_000061670.1.47543 WP_000061670.1.47552 WP_000061670.1.47553 WP_000061670.1.47573 WP_000061670.1.47607 WP_000061670.1.4761 WP_000061670.1.47715 WP_000061670.1.47816 WP_000061670.1.47828 WP_000061670.1.47863 WP_000061670.1.47903 WP_000061670.1.47917 WP_000061670.1.47937 WP_000061670.1.48026 WP_000061670.1.48042 WP_000061670.1.48056 WP_000061670.1.48115 WP_000061670.1.4819 WP_000061670.1.4824 WP_000061670.1.48280 WP_000061670.1.48320 WP_000061670.1.48380 WP_000061670.1.48415 WP_000061670.1.48451 WP_000061670.1.48457 WP_000061670.1.48485 WP_000061670.1.48495 WP_000061670.1.48509 WP_000061670.1.48527 WP_000061670.1.4855 WP_000061670.1.48642 WP_000061670.1.48692 WP_000061670.1.48700 WP_000061670.1.48717 WP_000061670.1.48785 WP_000061670.1.48824 WP_000061670.1.4887 WP_000061670.1.489 WP_000061670.1.48925 WP_000061670.1.48977 WP_000061670.1.48988 WP_000061670.1.49083 WP_000061670.1.4911 WP_000061670.1.49228 WP_000061670.1.4925 WP_000061670.1.49261 WP_000061670.1.49318 WP_000061670.1.4935 WP_000061670.1.49380 WP_000061670.1.49405 WP_000061670.1.4941 WP_000061670.1.49463 WP_000061670.1.49564 WP_000061670.1.49584 WP_000061670.1.49639 WP_000061670.1.4967 WP_000061670.1.49673 WP_000061670.1.49701 WP_000061670.1.49705 WP_000061670.1.49789 WP_000061670.1.49849 WP_000061670.1.49866 WP_000061670.1.49896 WP_000061670.1.49928 WP_000061670.1.49938 WP_000061670.1.49960 WP_000061670.1.49992 WP_000061670.1.49993 WP_000061670.1.5 WP_000061670.1.50011 WP_000061670.1.50097 WP_000061670.1.50111 WP_000061670.1.50135 WP_000061670.1.5014 WP_000061670.1.50150 WP_000061670.1.50164 WP_000061670.1.50208 WP_000061670.1.50216 WP_000061670.1.50220 WP_000061670.1.50223 WP_000061670.1.50267 WP_000061670.1.50298 WP_000061670.1.503 WP_000061670.1.50617 WP_000061670.1.50641 WP_000061670.1.50705 WP_000061670.1.50789 WP_000061670.1.50807 WP_000061670.1.50815 WP_000061670.1.50851 WP_000061670.1.50859 WP_000061670.1.50867 WP_000061670.1.50872 WP_000061670.1.50892 WP_000061670.1.50998 WP_000061670.1.51063 WP_000061670.1.51254 WP_000061670.1.51303 WP_000061670.1.51314 WP_000061670.1.51328 WP_000061670.1.51369 WP_000061670.1.51378 WP_000061670.1.51437 WP_000061670.1.51536 WP_000061670.1.51569 WP_000061670.1.51578 WP_000061670.1.51592 WP_000061670.1.51597 WP_000061670.1.51620 WP_000061670.1.51640 WP_000061670.1.51663 WP_000061670.1.51709 WP_000061670.1.5171 WP_000061670.1.51805 WP_000061670.1.51856 WP_000061670.1.51861 WP_000061670.1.51876 WP_000061670.1.5193 WP_000061670.1.51966 WP_000061670.1.52030 WP_000061670.1.52032 WP_000061670.1.5206 WP_000061670.1.52103 WP_000061670.1.52138 WP_000061670.1.52189 WP_000061670.1.5220 WP_000061670.1.52310 WP_000061670.1.52325 WP_000061670.1.52338 WP_000061670.1.52342 WP_000061670.1.52392 WP_000061670.1.52394 WP_000061670.1.52426 WP_000061670.1.52445 WP_000061670.1.52619 WP_000061670.1.52644 WP_000061670.1.5274 WP_000061670.1.52766 WP_000061670.1.52769 WP_000061670.1.52779 WP_000061670.1.52806 WP_000061670.1.5281 WP_000061670.1.52837 WP_000061670.1.52839 WP_000061670.1.52840 WP_000061670.1.52885 WP_000061670.1.52935 WP_000061670.1.52955 WP_000061670.1.52980 WP_000061670.1.52982 WP_000061670.1.5300 WP_000061670.1.53023 WP_000061670.1.53052 WP_000061670.1.53076 WP_000061670.1.53097 WP_000061670.1.53144 WP_000061670.1.53146 WP_000061670.1.53199 WP_000061670.1.53284 WP_000061670.1.53331 WP_000061670.1.53390 WP_000061670.1.53498 WP_000061670.1.53510 WP_000061670.1.53533 WP_000061670.1.53539 WP_000061670.1.53593 WP_000061670.1.53616 WP_000061670.1.53638 WP_000061670.1.53703 WP_000061670.1.53708 WP_000061670.1.53740 WP_000061670.1.53762 WP_000061670.1.53854 WP_000061670.1.53954 WP_000061670.1.53965 WP_000061670.1.53985 WP_000061670.1.54 WP_000061670.1.54088 WP_000061670.1.54108 WP_000061670.1.5412 WP_000061670.1.54138 WP_000061670.1.54139 WP_000061670.1.54171 WP_000061670.1.54242 WP_000061670.1.54266 WP_000061670.1.54300 WP_000061670.1.54352 WP_000061670.1.54361 WP_000061670.1.54451 WP_000061670.1.54464 WP_000061670.1.54492 WP_000061670.1.54566 WP_000061670.1.54581 WP_000061670.1.54664 WP_000061670.1.54670 WP_000061670.1.54712 WP_000061670.1.54718 WP_000061670.1.54741 WP_000061670.1.54761 WP_000061670.1.54842 WP_000061670.1.54885 WP_000061670.1.5489 WP_000061670.1.54906 WP_000061670.1.54963 WP_000061670.1.54977 WP_000061670.1.55045 WP_000061670.1.55062 WP_000061670.1.55155 WP_000061670.1.55201 WP_000061670.1.55321 WP_000061670.1.55363 WP_000061670.1.55368 WP_000061670.1.55376 WP_000061670.1.55408 WP_000061670.1.55447 WP_000061670.1.55457 WP_000061670.1.55484 WP_000061670.1.55491 WP_000061670.1.55516 WP_000061670.1.55592 WP_000061670.1.55631 WP_000061670.1.55638 WP_000061670.1.55773 WP_000061670.1.55799 WP_000061670.1.55952 WP_000061670.1.55997 WP_000061670.1.56027 WP_000061670.1.56067 WP_000061670.1.56076 WP_000061670.1.56102 WP_000061670.1.56129 WP_000061670.1.56154 WP_000061670.1.56211 WP_000061670.1.56246 WP_000061670.1.5626 WP_000061670.1.56353 WP_000061670.1.56379 WP_000061670.1.56538 WP_000061670.1.56668 WP_000061670.1.56690 WP_000061670.1.56705 WP_000061670.1.56712 WP_000061670.1.56717 WP_000061670.1.56798 WP_000061670.1.56833 WP_000061670.1.56841 WP_000061670.1.5697 WP_000061670.1.56991 WP_000061670.1.57078 WP_000061670.1.57250 WP_000061670.1.57346 WP_000061670.1.57392 WP_000061670.1.57408 WP_000061670.1.57423 WP_000061670.1.57457 WP_000061670.1.57463 WP_000061670.1.57465 WP_000061670.1.57535 WP_000061670.1.57543 WP_000061670.1.57606 WP_000061670.1.57654 WP_000061670.1.5769 WP_000061670.1.57731 WP_000061670.1.5780 WP_000061670.1.57829 WP_000061670.1.57842 WP_000061670.1.57874 WP_000061670.1.57987 WP_000061670.1.58061 WP_000061670.1.58115 WP_000061670.1.5814 WP_000061670.1.58159 WP_000061670.1.5822 WP_000061670.1.58269 WP_000061670.1.58319 WP_000061670.1.58453 WP_000061670.1.58503 WP_000061670.1.58506 WP_000061670.1.58570 WP_000061670.1.58621 WP_000061670.1.58802 WP_000061670.1.58969 WP_000061670.1.590 WP_000061670.1.59078 WP_000061670.1.5908 WP_000061670.1.59107 WP_000061670.1.59118 WP_000061670.1.59232 WP_000061670.1.59281 WP_000061670.1.59325 WP_000061670.1.59354 WP_000061670.1.59416 WP_000061670.1.59417 WP_000061670.1.59450 WP_000061670.1.59456 WP_000061670.1.59476 WP_000061670.1.59488 WP_000061670.1.59522 WP_000061670.1.5961 WP_000061670.1.59649 WP_000061670.1.59754 WP_000061670.1.59765 WP_000061670.1.59769 WP_000061670.1.59802 WP_000061670.1.5988 WP_000061670.1.59897 WP_000061670.1.59944 WP_000061670.1.59957 WP_000061670.1.600 WP_000061670.1.60059 WP_000061670.1.60099 WP_000061670.1.60108 WP_000061670.1.60109 WP_000061670.1.60116 WP_000061670.1.60176 WP_000061670.1.60182 WP_000061670.1.60198 WP_000061670.1.60243 WP_000061670.1.60299 WP_000061670.1.60316 WP_000061670.1.60318 WP_000061670.1.60359 WP_000061670.1.60371 WP_000061670.1.60408 WP_000061670.1.60474 WP_000061670.1.60484 WP_000061670.1.60542 WP_000061670.1.60546 WP_000061670.1.60581 WP_000061670.1.60589 WP_000061670.1.60609 WP_000061670.1.60616 WP_000061670.1.60655 WP_000061670.1.60669 WP_000061670.1.60678 WP_000061670.1.60697 WP_000061670.1.60894 WP_000061670.1.60933 WP_000061670.1.61105 WP_000061670.1.6112 WP_000061670.1.61172 WP_000061670.1.61173 WP_000061670.1.61291 WP_000061670.1.61336 WP_000061670.1.61410 WP_000061670.1.61441 WP_000061670.1.61452 WP_000061670.1.61477 WP_000061670.1.61516 WP_000061670.1.61527 WP_000061670.1.61578 WP_000061670.1.61637 WP_000061670.1.61681 WP_000061670.1.61704 WP_000061670.1.61759 WP_000061670.1.61974 WP_000061670.1.62011 WP_000061670.1.62023 WP_000061670.1.62032 WP_000061670.1.62067 WP_000061670.1.62150 WP_000061670.1.62191 WP_000061670.1.6221 WP_000061670.1.62242 WP_000061670.1.62308 WP_000061670.1.62368 WP_000061670.1.624 WP_000061670.1.62428 WP_000061670.1.62435 WP_000061670.1.62543 WP_000061670.1.62549 WP_000061670.1.6257 WP_000061670.1.62622 WP_000061670.1.62683 WP_000061670.1.62712 WP_000061670.1.62732 WP_000061670.1.62767 WP_000061670.1.6277 WP_000061670.1.62817 WP_000061670.1.62868 WP_000061670.1.6289 WP_000061670.1.62924 WP_000061670.1.62935 WP_000061670.1.63028 WP_000061670.1.63219 WP_000061670.1.63241 WP_000061670.1.63252 WP_000061670.1.63274 WP_000061670.1.63303 WP_000061670.1.63340 WP_000061670.1.63344 WP_000061670.1.63354 WP_000061670.1.63391 WP_000061670.1.63405 WP_000061670.1.63426 WP_000061670.1.63429 WP_000061670.1.6352 WP_000061670.1.63537 WP_000061670.1.63609 WP_000061670.1.63636 WP_000061670.1.63639 WP_000061670.1.63649 WP_000061670.1.63681 WP_000061670.1.63796 WP_000061670.1.63857 WP_000061670.1.63906 WP_000061670.1.63933 WP_000061670.1.63949 WP_000061670.1.64044 WP_000061670.1.64129 WP_000061670.1.64177 WP_000061670.1.64214 WP_000061670.1.64218 WP_000061670.1.64231 WP_000061670.1.64310 WP_000061670.1.6434 WP_000061670.1.64428 WP_000061670.1.64465 WP_000061670.1.6454 WP_000061670.1.6458 WP_000061670.1.64586 WP_000061670.1.64604 WP_000061670.1.64610 WP_000061670.1.64639 WP_000061670.1.64646 WP_000061670.1.64658 WP_000061670.1.64761 WP_000061670.1.64834 WP_000061670.1.64907 WP_000061670.1.64955 WP_000061670.1.64964 WP_000061670.1.65003 WP_000061670.1.65005 WP_000061670.1.65058 WP_000061670.1.65080 WP_000061670.1.6513 WP_000061670.1.65154 WP_000061670.1.6519 WP_000061670.1.65267 WP_000061670.1.65325 WP_000061670.1.65342 WP_000061670.1.65373 WP_000061670.1.65434 WP_000061670.1.65496 WP_000061670.1.65506 WP_000061670.1.65527 WP_000061670.1.65556 WP_000061670.1.65560 WP_000061670.1.6557 WP_000061670.1.65584 WP_000061670.1.65592 WP_000061670.1.65630 WP_000061670.1.65680 WP_000061670.1.65804 WP_000061670.1.65866 WP_000061670.1.65872 WP_000061670.1.65890 WP_000061670.1.65939 WP_000061670.1.65955 WP_000061670.1.65970 WP_000061670.1.65995 WP_000061670.1.66140 WP_000061670.1.66142 WP_000061670.1.66189 WP_000061670.1.66200 WP_000061670.1.66210 WP_000061670.1.66215 WP_000061670.1.66431 WP_000061670.1.66458 WP_000061670.1.66475 WP_000061670.1.66491 WP_000061670.1.66496 WP_000061670.1.66541 WP_000061670.1.66591 WP_000061670.1.66636 WP_000061670.1.66689 WP_000061670.1.66691 WP_000061670.1.66716 WP_000061670.1.66717 WP_000061670.1.66752 WP_000061670.1.66771 WP_000061670.1.66782 WP_000061670.1.66806 WP_000061670.1.66899 WP_000061670.1.66960 WP_000061670.1.66972 WP_000061670.1.67003 WP_000061670.1.67009 WP_000061670.1.67141 WP_000061670.1.6717 WP_000061670.1.67316 WP_000061670.1.67361 WP_000061670.1.67419 WP_000061670.1.67426 WP_000061670.1.67486 WP_000061670.1.67500 WP_000061670.1.67578 WP_000061670.1.67597 WP_000061670.1.67601 WP_000061670.1.67656 WP_000061670.1.67661 WP_000061670.1.6767 WP_000061670.1.67702 WP_000061670.1.67728 WP_000061670.1.67746 WP_000061670.1.67823 WP_000061670.1.67862 WP_000061670.1.67869 WP_000061670.1.67895 WP_000061670.1.67922 WP_000061670.1.67939 WP_000061670.1.68013 WP_000061670.1.68015 WP_000061670.1.68024 WP_000061670.1.68065 WP_000061670.1.68086 WP_000061670.1.68087 WP_000061670.1.68119 WP_000061670.1.68132 WP_000061670.1.68168 WP_000061670.1.6820 WP_000061670.1.68225 WP_000061670.1.68258 WP_000061670.1.68315 WP_000061670.1.6841 WP_000061670.1.68428 WP_000061670.1.68454 WP_000061670.1.6847 WP_000061670.1.6851 WP_000061670.1.68603 WP_000061670.1.6861 WP_000061670.1.68698 WP_000061670.1.68705 WP_000061670.1.68726 WP_000061670.1.68830 WP_000061670.1.68837 WP_000061670.1.68858 WP_000061670.1.68885 WP_000061670.1.689 WP_000061670.1.68904 WP_000061670.1.68930 WP_000061670.1.68933 WP_000061670.1.69024 WP_000061670.1.69046 WP_000061670.1.69093 WP_000061670.1.69117 WP_000061670.1.69121 WP_000061670.1.69172 WP_000061670.1.69193 WP_000061670.1.69242 WP_000061670.1.69257 WP_000061670.1.69364 WP_000061670.1.69379 WP_000061670.1.69419 WP_000061670.1.69424 WP_000061670.1.69458 WP_000061670.1.69478 WP_000061670.1.6952 WP_000061670.1.69568 WP_000061670.1.69586 WP_000061670.1.69609 WP_000061670.1.6962 WP_000061670.1.69665 WP_000061670.1.69815 WP_000061670.1.69859 WP_000061670.1.69929 WP_000061670.1.69930 WP_000061670.1.7002 WP_000061670.1.70025 WP_000061670.1.70154 WP_000061670.1.70197 WP_000061670.1.70283 WP_000061670.1.70297 WP_000061670.1.70354 WP_000061670.1.70461 WP_000061670.1.70542 WP_000061670.1.70739 WP_000061670.1.70827 WP_000061670.1.70891 WP_000061670.1.70993 WP_000061670.1.71004 WP_000061670.1.71005 WP_000061670.1.71131 WP_000061670.1.71151 WP_000061670.1.71168 WP_000061670.1.71204 WP_000061670.1.71220 WP_000061670.1.71335 WP_000061670.1.71340 WP_000061670.1.71347 WP_000061670.1.71362 WP_000061670.1.71413 WP_000061670.1.71435 WP_000061670.1.71508 WP_000061670.1.71539 WP_000061670.1.71616 WP_000061670.1.71650 WP_000061670.1.71679 WP_000061670.1.71719 WP_000061670.1.7172 WP_000061670.1.71796 WP_000061670.1.71823 WP_000061670.1.71825 WP_000061670.1.71857 WP_000061670.1.71898 WP_000061670.1.71960 WP_000061670.1.71969 WP_000061670.1.71971 WP_000061670.1.72010 WP_000061670.1.72081 WP_000061670.1.72084 WP_000061670.1.7213 WP_000061670.1.72158 WP_000061670.1.72265 WP_000061670.1.72295 WP_000061670.1.72299 WP_000061670.1.72317 WP_000061670.1.72334 WP_000061670.1.72356 WP_000061670.1.72430 WP_000061670.1.7244 WP_000061670.1.72476 WP_000061670.1.72512 WP_000061670.1.72538 WP_000061670.1.72577 WP_000061670.1.72997 WP_000061670.1.73031 WP_000061670.1.73056 WP_000061670.1.73076 WP_000061670.1.73146 WP_000061670.1.73162 WP_000061670.1.73218 WP_000061670.1.73238 WP_000061670.1.7330 WP_000061670.1.73341 WP_000061670.1.73347 WP_000061670.1.73348 WP_000061670.1.73372 WP_000061670.1.73375 WP_000061670.1.73392 WP_000061670.1.73434 WP_000061670.1.73446 WP_000061670.1.73542 WP_000061670.1.73636 WP_000061670.1.73645 WP_000061670.1.73683 WP_000061670.1.73699 WP_000061670.1.73727 WP_000061670.1.73737 WP_000061670.1.73779 WP_000061670.1.73806 WP_000061670.1.73820 WP_000061670.1.73867 WP_000061670.1.73874 WP_000061670.1.73875 WP_000061670.1.73932 WP_000061670.1.73938 WP_000061670.1.74122 WP_000061670.1.74312 WP_000061670.1.74318 WP_000061670.1.74322 WP_000061670.1.74324 WP_000061670.1.74361 WP_000061670.1.74393 WP_000061670.1.74424 WP_000061670.1.74463 WP_000061670.1.7453 WP_000061670.1.74700 WP_000061670.1.74709 WP_000061670.1.74711 WP_000061670.1.74819 WP_000061670.1.74838 WP_000061670.1.74869 WP_000061670.1.749 WP_000061670.1.74908 WP_000061670.1.74930 WP_000061670.1.74949 WP_000061670.1.74969 WP_000061670.1.74989 WP_000061670.1.75104 WP_000061670.1.75105 WP_000061670.1.75107 WP_000061670.1.75121 WP_000061670.1.75162 WP_000061670.1.7521 WP_000061670.1.75212 WP_000061670.1.75225 WP_000061670.1.75321 WP_000061670.1.75386 WP_000061670.1.75412 WP_000061670.1.75416 WP_000061670.1.75459 WP_000061670.1.75478 WP_000061670.1.75489 WP_000061670.1.75562 WP_000061670.1.75569 WP_000061670.1.75620 WP_000061670.1.75628 WP_000061670.1.75667 WP_000061670.1.75738 WP_000061670.1.75812 WP_000061670.1.75859 WP_000061670.1.75890 WP_000061670.1.75895 WP_000061670.1.75896 WP_000061670.1.75939 WP_000061670.1.76026 WP_000061670.1.7606 WP_000061670.1.76101 WP_000061670.1.76117 WP_000061670.1.76216 WP_000061670.1.76250 WP_000061670.1.76260 WP_000061670.1.76329 WP_000061670.1.76372 WP_000061670.1.76464 WP_000061670.1.76493 WP_000061670.1.7651 WP_000061670.1.76523 WP_000061670.1.76571 WP_000061670.1.76585 WP_000061670.1.76587 WP_000061670.1.76590 WP_000061670.1.7662 WP_000061670.1.76682 WP_000061670.1.76698 WP_000061670.1.76787 WP_000061670.1.76809 WP_000061670.1.76871 WP_000061670.1.76953 WP_000061670.1.76981 WP_000061670.1.77159 WP_000061670.1.77164 WP_000061670.1.77226 WP_000061670.1.77237 WP_000061670.1.77257 WP_000061670.1.77274 WP_000061670.1.77277 WP_000061670.1.77347 WP_000061670.1.77396 WP_000061670.1.77531 WP_000061670.1.77539 WP_000061670.1.7757 WP_000061670.1.77590 WP_000061670.1.77634 WP_000061670.1.77660 WP_000061670.1.77711 WP_000061670.1.77758 WP_000061670.1.77776 WP_000061670.1.77778 WP_000061670.1.77787 WP_000061670.1.77812 WP_000061670.1.77815 WP_000061670.1.77891 WP_000061670.1.77903 WP_000061670.1.7791 WP_000061670.1.77969 WP_000061670.1.77996 WP_000061670.1.78042 WP_000061670.1.78094 WP_000061670.1.78154 WP_000061670.1.7816 WP_000061670.1.78197 WP_000061670.1.7825 WP_000061670.1.78261 WP_000061670.1.78263 WP_000061670.1.78355 WP_000061670.1.78361 WP_000061670.1.78461 WP_000061670.1.78505 WP_000061670.1.78530 WP_000061670.1.78543 WP_000061670.1.78561 WP_000061670.1.7864 WP_000061670.1.7865 WP_000061670.1.7866 WP_000061670.1.78660 WP_000061670.1.78768 WP_000061670.1.78769 WP_000061670.1.78783 WP_000061670.1.78808 WP_000061670.1.78968 WP_000061670.1.78984 WP_000061670.1.78988 WP_000061670.1.79010 WP_000061670.1.79020 WP_000061670.1.79028 WP_000061670.1.79072 WP_000061670.1.79078 WP_000061670.1.7908 WP_000061670.1.79116 WP_000061670.1.79181 WP_000061670.1.79188 WP_000061670.1.7921 WP_000061670.1.79229 WP_000061670.1.79242 WP_000061670.1.79254 WP_000061670.1.79260 WP_000061670.1.79261 WP_000061670.1.79284 WP_000061670.1.793 WP_000061670.1.79328 WP_000061670.1.7938 WP_000061670.1.79405 WP_000061670.1.79470 WP_000061670.1.7949 WP_000061670.1.79513 WP_000061670.1.79567 WP_000061670.1.79701 WP_000061670.1.79720 WP_000061670.1.79728 WP_000061670.1.79736 WP_000061670.1.79774 WP_000061670.1.7978 WP_000061670.1.79789 WP_000061670.1.79797 WP_000061670.1.79889 WP_000061670.1.79909 WP_000061670.1.79938 WP_000061670.1.79979 WP_000061670.1.80092 WP_000061670.1.80121 WP_000061670.1.80125 WP_000061670.1.80138 WP_000061670.1.80143 WP_000061670.1.80162 WP_000061670.1.80195 WP_000061670.1.8021 WP_000061670.1.80270 WP_000061670.1.80347 WP_000061670.1.8039 WP_000061670.1.80528 WP_000061670.1.80585 WP_000061670.1.80655 WP_000061670.1.80665 WP_000061670.1.8071 WP_000061670.1.80712 WP_000061670.1.80730 WP_000061670.1.80766 WP_000061670.1.80769 WP_000061670.1.80887 WP_000061670.1.80897 WP_000061670.1.80905 WP_000061670.1.80987 WP_000061670.1.80989 WP_000061670.1.80997 WP_000061670.1.81002 WP_000061670.1.8103 WP_000061670.1.81068 WP_000061670.1.81079 WP_000061670.1.8108 WP_000061670.1.81146 WP_000061670.1.81161 WP_000061670.1.81238 WP_000061670.1.81240 WP_000061670.1.81294 WP_000061670.1.81319 WP_000061670.1.81345 WP_000061670.1.81365 WP_000061670.1.81373 WP_000061670.1.81400 WP_000061670.1.81412 WP_000061670.1.81441 WP_000061670.1.81466 WP_000061670.1.81468 WP_000061670.1.81597 WP_000061670.1.81700 WP_000061670.1.81704 WP_000061670.1.81764 WP_000061670.1.82036 WP_000061670.1.82039 WP_000061670.1.82040 WP_000061670.1.82082 WP_000061670.1.82090 WP_000061670.1.82110 WP_000061670.1.82203 WP_000061670.1.82235 WP_000061670.1.82286 WP_000061670.1.8230 WP_000061670.1.82355 WP_000061670.1.82366 WP_000061670.1.82371 WP_000061670.1.82404 WP_000061670.1.82453 WP_000061670.1.82489 WP_000061670.1.82504 WP_000061670.1.82538 WP_000061670.1.82542 WP_000061670.1.82561 WP_000061670.1.82633 WP_000061670.1.8264 WP_000061670.1.82786 WP_000061670.1.828 WP_000061670.1.82809 WP_000061670.1.82838 WP_000061670.1.82848 WP_000061670.1.82861 WP_000061670.1.82967 WP_000061670.1.83001 WP_000061670.1.8301 WP_000061670.1.83024 WP_000061670.1.83098 WP_000061670.1.8312 WP_000061670.1.83178 WP_000061670.1.83222 WP_000061670.1.83297 WP_000061670.1.83400 WP_000061670.1.83410 WP_000061670.1.83450 WP_000061670.1.83452 WP_000061670.1.83474 WP_000061670.1.8348 WP_000061670.1.83504 WP_000061670.1.83594 WP_000061670.1.836 WP_000061670.1.83679 WP_000061670.1.83693 WP_000061670.1.8377 WP_000061670.1.838 WP_000061670.1.83817 WP_000061670.1.83889 WP_000061670.1.83896 WP_000061670.1.839 WP_000061670.1.83900 WP_000061670.1.83970 WP_000061670.1.84012 WP_000061670.1.84034 WP_000061670.1.84058 WP_000061670.1.84099 WP_000061670.1.84139 WP_000061670.1.84171 WP_000061670.1.84173 WP_000061670.1.84189 WP_000061670.1.84247 WP_000061670.1.84250 WP_000061670.1.84308 WP_000061670.1.84318 WP_000061670.1.84332 WP_000061670.1.84387 WP_000061670.1.84447 WP_000061670.1.84490 WP_000061670.1.84527 WP_000061670.1.84536 WP_000061670.1.84550 WP_000061670.1.84571 WP_000061670.1.84618 WP_000061670.1.84663 WP_000061670.1.84688 WP_000061670.1.84691 WP_000061670.1.84706 WP_000061670.1.8472 WP_000061670.1.84769 WP_000061670.1.84864 WP_000061670.1.84898 WP_000061670.1.84921 WP_000061670.1.84944 WP_000061670.1.85101 WP_000061670.1.85149 WP_000061670.1.85158 WP_000061670.1.85168 WP_000061670.1.85185 WP_000061670.1.85254 WP_000061670.1.85279 WP_000061670.1.85299 WP_000061670.1.85359 WP_000061670.1.85364 WP_000061670.1.85449 WP_000061670.1.85468 WP_000061670.1.85472 WP_000061670.1.85493 WP_000061670.1.85544 WP_000061670.1.85616 WP_000061670.1.85683 WP_000061670.1.85711 WP_000061670.1.85716 WP_000061670.1.85743 WP_000061670.1.85831 WP_000061670.1.85833 WP_000061670.1.85846 WP_000061670.1.85865 WP_000061670.1.85889 WP_000061670.1.85922 WP_000061670.1.8596 WP_000061670.1.8601 WP_000061670.1.86100 WP_000061670.1.86102 WP_000061670.1.86131 WP_000061670.1.86163 WP_000061670.1.86180 WP_000061670.1.86242 WP_000061670.1.86277 WP_000061670.1.86324 WP_000061670.1.86336 WP_000061670.1.86385 WP_000061670.1.86536 WP_000061670.1.86715 WP_000061670.1.86869 WP_000061670.1.86890 WP_000061670.1.86908 WP_000061670.1.86922 WP_000061670.1.86966 WP_000061670.1.86973 WP_000061670.1.86976 WP_000061670.1.87024 WP_000061670.1.87048 WP_000061670.1.87099 WP_000061670.1.87111 WP_000061670.1.87142 WP_000061670.1.87156 WP_000061670.1.87216 WP_000061670.1.87292 WP_000061670.1.87312 WP_000061670.1.87319 WP_000061670.1.87545 WP_000061670.1.87562 WP_000061670.1.87567 WP_000061670.1.87598 WP_000061670.1.87688 WP_000061670.1.87717 WP_000061670.1.87727 WP_000061670.1.87746 WP_000061670.1.87830 WP_000061670.1.88040 WP_000061670.1.88093 WP_000061670.1.88109 WP_000061670.1.88115 WP_000061670.1.88131 WP_000061670.1.88133 WP_000061670.1.88163 WP_000061670.1.88183 WP_000061670.1.885 WP_000061670.1.88512 WP_000061670.1.88596 WP_000061670.1.8860 WP_000061670.1.88613 WP_000061670.1.88654 WP_000061670.1.88842 WP_000061670.1.88851 WP_000061670.1.88956 WP_000061670.1.89030 WP_000061670.1.89033 WP_000061670.1.89107 WP_000061670.1.89172 WP_000061670.1.89199 WP_000061670.1.89209 WP_000061670.1.89218 WP_000061670.1.89289 WP_000061670.1.89376 WP_000061670.1.89383 WP_000061670.1.89410 WP_000061670.1.89412 WP_000061670.1.89419 WP_000061670.1.89459 WP_000061670.1.89484 WP_000061670.1.89568 WP_000061670.1.89611 WP_000061670.1.89643 WP_000061670.1.89653 WP_000061670.1.89685 WP_000061670.1.89724 WP_000061670.1.89790 WP_000061670.1.89792 WP_000061670.1.89836 WP_000061670.1.89878 WP_000061670.1.89906 WP_000061670.1.9 WP_000061670.1.9008 WP_000061670.1.90087 WP_000061670.1.90118 WP_000061670.1.90132 WP_000061670.1.90262 WP_000061670.1.90310 WP_000061670.1.90362 WP_000061670.1.90375 WP_000061670.1.90378 WP_000061670.1.9038 WP_000061670.1.90413 WP_000061670.1.90584 WP_000061670.1.90593 WP_000061670.1.90656 WP_000061670.1.90697 WP_000061670.1.90704 WP_000061670.1.90743 WP_000061670.1.90755 WP_000061670.1.90781 WP_000061670.1.90795 WP_000061670.1.90932 WP_000061670.1.90943 WP_000061670.1.90953 WP_000061670.1.91061 WP_000061670.1.91085 WP_000061670.1.91206 WP_000061670.1.91241 WP_000061670.1.91249 WP_000061670.1.91286 WP_000061670.1.91299 WP_000061670.1.91335 WP_000061670.1.9134 WP_000061670.1.91355 WP_000061670.1.91442 WP_000061670.1.91477 WP_000061670.1.91502 WP_000061670.1.91523 WP_000061670.1.9154 WP_000061670.1.91612 WP_000061670.1.91627 WP_000061670.1.91696 WP_000061670.1.9172 WP_000061670.1.91754 WP_000061670.1.91762 WP_000061670.1.91780 WP_000061670.1.91789 WP_000061670.1.91832 WP_000061670.1.91854 WP_000061670.1.91906 WP_000061670.1.91908 WP_000061670.1.91941 WP_000061670.1.91998 WP_000061670.1.92112 WP_000061670.1.92128 WP_000061670.1.92179 WP_000061670.1.92230 WP_000061670.1.9228 WP_000061670.1.9233 WP_000061670.1.92365 WP_000061670.1.92417 WP_000061670.1.92468 WP_000061670.1.92513 WP_000061670.1.92515 WP_000061670.1.92578 WP_000061670.1.92611 WP_000061670.1.92687 WP_000061670.1.92711 WP_000061670.1.92745 WP_000061670.1.92749 WP_000061670.1.92815 WP_000061670.1.92830 WP_000061670.1.92945 WP_000061670.1.92998 WP_000061670.1.9309 WP_000061670.1.93094 WP_000061670.1.93114 WP_000061670.1.93151 WP_000061670.1.9316 WP_000061670.1.93280 WP_000061670.1.93437 WP_000061670.1.93451 WP_000061670.1.93482 WP_000061670.1.93485 WP_000061670.1.93570 WP_000061670.1.93580 WP_000061670.1.93594 WP_000061670.1.93682 WP_000061670.1.93778 WP_000061670.1.93796 WP_000061670.1.93849 WP_000061670.1.93868 WP_000061670.1.93948 WP_000061670.1.93991 WP_000061670.1.94012 WP_000061670.1.94015 WP_000061670.1.94034 WP_000061670.1.94129 WP_000061670.1.94144 WP_000061670.1.94224 WP_000061670.1.94265 WP_000061670.1.94387 WP_000061670.1.9439 WP_000061670.1.94410 WP_000061670.1.94502 WP_000061670.1.94581 WP_000061670.1.9460 WP_000061670.1.94668 WP_000061670.1.94672 WP_000061670.1.9472 WP_000061670.1.94723 WP_000061670.1.94725 WP_000061670.1.94740 WP_000061670.1.94816 WP_000061670.1.94826 WP_000061670.1.94900 WP_000061670.1.94948 WP_000061670.1.95001 WP_000061670.1.95026 WP_000061670.1.95040 WP_000061670.1.95092 WP_000061670.1.95109 WP_000061670.1.95111 WP_000061670.1.95118 WP_000061670.1.95172 WP_000061670.1.95220 WP_000061670.1.95260 WP_000061670.1.95269 WP_000061670.1.95270 WP_000061670.1.9536 WP_000061670.1.95363 WP_000061670.1.95498 WP_000061670.1.95503 WP_000061670.1.95539 WP_000061670.1.95599 WP_000061670.1.95622 WP_000061670.1.95653 WP_000061670.1.95665 WP_000061670.1.95755 WP_000061670.1.95844 WP_000061670.1.95859 WP_000061670.1.95873 WP_000061670.1.95923 WP_000061670.1.9593 WP_000061670.1.96029 WP_000061670.1.96046 WP_000061670.1.96119 WP_000061670.1.962 WP_000061670.1.96220 WP_000061670.1.9629 WP_000061670.1.96323 WP_000061670.1.96325 WP_000061670.1.9645 WP_000061670.1.96518 WP_000061670.1.96530 WP_000061670.1.96556 WP_000061670.1.96598 WP_000061670.1.96696 WP_000061670.1.96741 WP_000061670.1.96747 WP_000061670.1.96760 WP_000061670.1.96930 WP_000061670.1.96942 WP_000061670.1.96966 WP_000061670.1.96998 WP_000061670.1.97032 WP_000061670.1.97038 WP_000061670.1.9714 WP_000061670.1.97163 WP_000061670.1.97180 WP_000061670.1.97300 WP_000061670.1.9733 WP_000061670.1.97404 WP_000061670.1.97520 WP_000061670.1.97647 WP_000061670.1.97661 WP_000061670.1.97709 WP_000061670.1.97710 WP_000061670.1.97780 WP_000061670.1.97844 WP_000061670.1.97893 WP_000061670.1.97920 WP_000061670.1.9794 WP_000061670.1.98004 WP_000061670.1.98007 WP_000061670.1.98068 WP_000061670.1.98150 WP_000061670.1.982 WP_000061670.1.98224 WP_000061670.1.98272 WP_000061670.1.9832 WP_000061670.1.98321 WP_000061670.1.98354 WP_000061670.1.98369 WP_000061670.1.98434 WP_000061670.1.98523 WP_000061670.1.98561 WP_000061670.1.98595 WP_000061670.1.98625 WP_000061670.1.98666 WP_000061670.1.98691 WP_000061670.1.98692 WP_000061670.1.987 WP_000061670.1.98769 WP_000061670.1.98806 WP_000061670.1.98835 WP_000061670.1.98919 WP_000061670.1.98950 WP_000061670.1.98965 WP_000061670.1.98968 WP_000061670.1.98986 WP_000061670.1.98998 WP_000061670.1.99041 WP_000061670.1.99048 WP_000061670.1.99049 WP_000061670.1.99077 WP_000061670.1.99120 WP_000061670.1.99162 WP_000061670.1.99188 WP_000061670.1.99206 WP_000061670.1.99250 WP_000061670.1.99391 WP_000061670.1.99395 WP_000061670.1.99420 WP_000061670.1.99429 WP_000061670.1.99449 WP_000061670.1.99464 WP_000061670.1.9952 WP_000061670.1.99555 WP_000061670.1.99653 WP_000061670.1.99665 WP_000061670.1.99697 WP_000061670.1.99770 WP_000061670.1.99775 WP_000061670.1.99806 WP_000061670.1.99825 WP_000061670.1.99833 WP_000061670.1.99868 WP_000061670.1.99931 WP_000061670.1.99964 WP_000061670.1.9997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]