SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 480224.Chy400_2208 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  480224.Chy400_2208
Domain Number 1 Region: 299-494
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-50
Family Ribonuclease PH domain 1-like 0.00000811
Further Details:      
 
Domain Number 2 Region: 4-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-48
Family Ribonuclease PH domain 1-like 0.0000215
Further Details:      
 
Domain Number 3 Region: 147-239
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.14e-28
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 456-555
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.68e-28
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 5 Region: 613-702
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.31e-23
Family Cold shock DNA-binding domain-like 0.00073
Further Details:      
 
Domain Number 6 Region: 559-636
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.23e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 7 Region: 240-326
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.6e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 480224.Chy400_2208
Sequence length 755
Comment (Chloroflexus Y 400 fl)
Sequence
MTERNIYSVSAEIAGRTLTLEAGRFAEQADGAVVARYGDTMLLATVVCAKEAREGTDFFP
LTVDYEEKMYAVGKIPGNFFKREGRPTTTAILISRLTDRPLRPLFPKGFYNEVQVIITTF
SIDMENDPGPLAIIAASAALCISDIPFAGPVGAVQMGHLNGQLVVNPKMNEIADSRLDLV
VAGTKDAVLMVEAGAYELTEDEMLQAVIDGHAVCKQICDLQEQLVQLCGKPKRPFTPPVV
DTSLEEAISAWMGDRLRKAVRSPIKQEREAQTEALKAEVIAHFTADEPEEEIANRTKEVT
KAFEKLLKDEVRNAILDEGIRVDGRALDEIRPISIEVGVIPRVHGSAVFTRGQTQVLTIT
TLGSPGDEQKVDDLGIETSKRYIHHYNFPPFSTGEVRRIGTPRRRDIGHGALAERSLYAV
LPDEKDFPYTIRLVSEVLSSNGSSSMASVCGSSLSLMDAGVPIKAPVAGVAMGLITGEDG
RWRVLTDIQGLEDALGDMDFKVAGTAKGVTGLQMDIKTTGITYEIMREAFAQARAGRLFI
LDKMNEVISAPRPELSIYAPRIMTIQIPVDKIGALIGPGGKTIRNICETTGAQIDIEDDG
RVFITTPDGAAARQAISMIEGLTREAKVGDIFLGKVVSIKPFGAFVNILPGKDGMVHVSE
LDEKRVENVEDVVSLGDEINVMVIDIDRTTGKISLSRRAVLTGETPEERKAAGAAPRPRP
REEQRGGRDEPRSLRDELRGPRREGDRPRPRRRDD
Download sequence
Identical sequences A9WEJ7 B9LH03
324602.Caur_2047 480224.Chy400_2208 WP_012257913.1.35445 YP_001635648.1.55443 gi|163847604|ref|YP_001635648.1| gi|222525460|ref|YP_002569931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]