SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 480224.Chy400_3800 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  480224.Chy400_3800
Domain Number - Region: 207-246
Classification Level Classification E-value
Superfamily BT0923-like 0.0149
Family BT0923-like 0.014
Further Details:      
 
Domain Number - Region: 130-241
Classification Level Classification E-value
Superfamily BT0923-like 0.0196
Family BT0923-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 480224.Chy400_3800
Sequence length 272
Comment (Chloroflexus Y 400 fl)
Sequence
MNRTMFLISAALTAFVLVVIGGVASRLSVSEPVSEVPTEIVIESTPITVPAIDPTVEALI
REREAAYQAALAEAQQRLAEANQRLSAAQQQLDEVTTEAQAAPAVAVPAAAPAAVQAPAA
PPAPTYAVSPEQAQAIAQAAAGNATLMRAPELVSIQGAPAYEVIFDRGAIYVDTQTGAIL
ANTIAEIAQSANPISEEQAIAAAVAYLGGGTVREVEREYEHGVDAYEVKFSDGSEVYVDA
YTGQVVYAKVKNVYGDDGDEHEDEKEKDDHDD
Download sequence
Identical sequences A9WA26
gi|222527021|ref|YP_002571492.1| 324602.Caur_3524 480224.Chy400_3800 WP_012259361.1.35445 YP_001637097.1.55443 gi|163849053|ref|YP_001637097.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]