SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 481743.GYMC10_4137 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  481743.GYMC10_4137
Domain Number 1 Region: 292-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-48
Family Ribonuclease PH domain 1-like 0.0000193
Further Details:      
 
Domain Number 2 Region: 4-141
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-48
Family Ribonuclease PH domain 1-like 0.0000195
Further Details:      
 
Domain Number 3 Region: 142-232
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.7e-30
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 4 Region: 449-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-29
Family Ribonuclease PH domain 2-like 0.0000843
Further Details:      
 
Domain Number 5 Region: 554-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.48e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 6 Region: 619-696
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1e-21
Family Cold shock DNA-binding domain-like 0.00051
Further Details:      
 
Domain Number 7 Region: 235-320
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 6.02e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 481743.GYMC10_4137
Sequence length 701
Comment (Geobacillus Y412MC10)
Sequence
METRVEMQLGGRPLVFETGRLAKQANAAVMVRYGETAVLCTVTASSEPKDLDFFPLTVNY
EERLYAVGKIPGGFIKREGRPSEKAILASRLTDRPIRPLFPEGFRNDVQVLNLVMSVDQD
CEPEIAAMIGTSAALSISDVPFNGPIGGVAVGRVDGNFVVNPNIAEQEASDIYLVVAGTK
DAIMMVEAEANEVPEEVMLEAIMFGHEEIKKIVAKIEELVAACGKEKMAVKLHAVNETVN
REVREFAEARLVEAVRIEEKHARQDAIDAINDEAYTVFEEKYIETPELLKDVKEVLHDIV
KEEVRRLITHDKVRPDGRGLSEIRPIDCDTSLLPRTHGSGLFTRGQTQALSVCTLGALGD
VQILDGIDLEETKRFMHHYNFPPFSVGEARPLRAPGRREIGHGALGERALSKVIPNEVDF
PYTIRLVSEVIESNGSTSQASICASTLAMMDAGVPIKAPVAGVAMGLIKDGDHVSILTDI
QGMEDHLGDMDFKVAGTPDGVTAIQMDIKIDGIDRAILQEALQQAKEGRMHILGKMAEAI
QKPRETLSQYAPKIITMQINPDKIRDVIGAGGKIINKIIEETGVKIDIEQDGRVFIASSN
DEMNKKALSIIEGIVREVAVGEIYTGTVKRIEKFGAFVEILPNKDGLVHISQLSTERVAK
VEDVVAIGDVITVKVTEIDQQGRINLSRKAVLTTEASKSGS
Download sequence
Identical sequences A0A1H7FWH8 D3E6P1
gi|261407930|ref|YP_003244171.1| WP_015736299.1.24093 WP_015736299.1.35877 WP_015736299.1.52352 481743.GYMC10_4137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]