SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 481743.GYMC10_4632 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  481743.GYMC10_4632
Domain Number - Region: 27-83
Classification Level Classification E-value
Superfamily TM1646-like 0.00196
Family TM1646-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 481743.GYMC10_4632
Sequence length 88
Comment (Geobacillus Y412MC10)
Sequence
MNSHDSSLHSNSPSNSALDSVEKLHRAVSSAMSHPTEQLIQQAENSLSHTEQAVAQVIEQ
GNRNAVELAEELLGEEKERLSKLRSAKK
Download sequence
Identical sequences A0A1H7LRN2 A0A2A5LD76 D3EA88 F3ME28
481743.GYMC10_4632 WP_009593780.1.24093 WP_009593780.1.35877 WP_009593780.1.3965 WP_009593780.1.52352 gi|261408419|ref|YP_003244660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]