SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 481743.GYMC10_5122 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  481743.GYMC10_5122
Domain Number - Region: 4-34
Classification Level Classification E-value
Superfamily YfgJ-like 0.00262
Family YfgJ-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 481743.GYMC10_5122
Sequence length 187
Comment (Geobacillus Y412MC10)
Sequence
MEPTVCPWCQSEIVWDEEIGPEDTCPHCANELKGYRTLNIALQDEDEDEEDVVEEYEEAY
EPSDEEARDLHRIWGSDHESLSSLRTVDKYGEDHDLFAFEETVEGILDQQEEVPECLHCR
EYMLHAGTQHVSGEGFQPVHAPLIQAPILQPPYDLNVYVCPGCFHVQYNLAENDRLRMIK
SFIHKKE
Download sequence
Identical sequences D3EEP6
WP_015737139.1.35877 481743.GYMC10_5122 gi|261408899|ref|YP_003245140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]