SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 484019.THA_1819 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  484019.THA_1819
Domain Number 1 Region: 297-493
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-52
Family Ribonuclease PH domain 1-like 0.0000159
Further Details:      
 
Domain Number 2 Region: 5-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.8e-46
Family Ribonuclease PH domain 1-like 0.0000402
Further Details:      
 
Domain Number 3 Region: 456-554
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.06e-27
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 4 Region: 144-232
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.36e-27
Family Ribonuclease PH domain 2-like 0.0012
Further Details:      
 
Domain Number 5 Region: 561-647
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.79e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 6 Region: 625-694
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000125
Family Cold shock DNA-binding domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 484019.THA_1819
Sequence length 697
Comment (Thermosipho africanus TCF52B)
Sequence
MQFREWTKELFGRKMIVQHGKVAKQSAGSVWVQFGDSVVLATANISDRTIEGVDFVPLTV
EYQEKFYAAGKIPGGFIKREGKPSESAILSARLIDRPIRPLFPKYLRNDVQLIVTVLSVD
GNTPPDVTGIIAASLALNISKIPFEGIVAGVRLGYVDGKFVVFPTEEQLEKSRLDIVVAG
SKDAITMVEGEAKEVTEEEMVNALMVAHDAIKQIIEFEEEILSQFDVQKMEIEEPKPNET
LIGKFEEMISEEELRDKLLIKEKLERSAKLKEYRDQILEKIFEDVEMEDDEKILQESLLK
EYFDERTKKLMRKIIIEEGIRADGRKVDEIRPITCEVGVLPRTHGSALFTRGETQSLGIV
TLGAPMEEQIVDTIMEEGTKRFILHYNFPPFSVGEVKPLRGPGRREIGHGHLAERALKAV
VPSEEEFPYVVRVVSEILESNGSSSMATVCSGSLALMDAGVPIRTHVAGVAMGLIIEDGQ
EVVLTDIQGLEDHWGDMDFKVAGTRNGITAFQMDCKVAGVGEELLKRALQQAKEARMKIL
DIMFNTIEKPRESLSPYAPLIVTIEIDPMKVGELIGPGGKVIKSIIKEYDVEISIDDTTG
KVSIYGKDQKKVNEAIEYIKTITKDIEVGDVFEGKITRIEPYGIFVELMPGKIGLAHSSK
LGEDSKNFKEKYKIGDTIKVIVVNIDENGRIQLGKTN
Download sequence
Identical sequences B7IE23
WP_012580442.1.97851 gi|217077873|ref|YP_002335591.1| 484019.THA_1819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]