SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 485914.Hmuk_1289 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485914.Hmuk_1289
Domain Number 1 Region: 6-143
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 5.75e-46
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.00013
Further Details:      
 
Domain Number 2 Region: 145-275
Classification Level Classification E-value
Superfamily Translational machinery components 6.1e-39
Family ERF1/Dom34 middle domain-like 0.00041
Further Details:      
 
Domain Number 3 Region: 278-416
Classification Level Classification E-value
Superfamily L30e-like 2.77e-31
Family ERF1/Dom34 C-terminal domain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 485914.Hmuk_1289
Sequence length 417
Comment (Halomicrobium mukohataei DSM 12286)
Sequence
MSESEQEQSDKQKYEFKKVIEKLKGYDGSGTQLVTIYVPEDKQISDVVAHVTQEHSEASN
IKSKQTRTNVQDALTSIKDRLRYYGNAPPENGMVLFSGAVDSSGGRTEMVTEVLESPPDP
IESFRYHCDSDFLTEPLDEMLADKGLFGLIVLDRREANVGWLKGKRVEPVKSASSLVPGK
QRKGGQSAQRFARLRLEAIDNFYQEVAEMANDLFVSRRHEMNGILVGGPSPTKDEFLDGD
YLHHELGDNVLGKFDVAYTDESGLYDLVDAASEVLAEHEILQDKEAMEEFFKELHDGDLA
TYGFGPTRENLIMGSVDRLLISEDLRKDVLTYTCENGHDEYEMVDRSASIDDHDCSRCSE
TVPAEEAEREDAIDHLMEIAQQRGTETLFISTDFEKGEQLLSAFGGVAGLLRYSTGV
Download sequence
Identical sequences C7P2T8
485914.Hmuk_1289 WP_015762256.1.83741 gi|257387344|ref|YP_003177117.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]