SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 485914.Hmuk_2604 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485914.Hmuk_2604
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.28e-38
Family GHMP Kinase, N-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 189-306
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.35e-30
Family Mevalonate kinase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 485914.Hmuk_2604
Sequence length 327
Comment (Halomicrobium mukohataei DSM 12286)
Sequence
MVTASAPGKVYLFGEHAVVYGEPAVPCAIERRARVTVEERDEGLRVHLDDLTLDGFTIEY
SGDATGRPDVNVSESLVEAGVGYINEAVEQARDAADAPDAGFEISVESSIPLGAGIGSSA
AVVVGVIKAATAELGIEIDAREVAERAYRVEHTVQDGEASRADTFCSAMGGAVRVEGDDC
RRIEGVDTLPFVIGYDGGAGDTGALVAGVRQLRSEYDFAADTVEAVGDIVREGERALQAG
DLSELGELMDFNHGLLSALGVSSRSLDGMVWAARDAGALGAKLTGAGGNGCVVALDETDA
TETALSYTPGCENAFRAALDTEGVRIE
Download sequence
Identical sequences C7NZ21
WP_015763552.1.83741 gi|257388644|ref|YP_003178417.1| 485914.Hmuk_2604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]