SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 485915.Dret_1733 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485915.Dret_1733
Domain Number 1 Region: 104-287
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.24e-40
Family Nitrogenase iron protein-like 0.092
Further Details:      
 
Domain Number 2 Region: 10-64
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000471
Family Eukaryotic type KH-domain (KH-domain type I) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 485915.Dret_1733
Sequence length 326
Comment (Desulfohalobium retbaense DSM 5692)
Sequence
MAEQRITFHDADIARELFGAQERNLKLVRERTGAEVNVRGTEVLVRGTEEAVAWAASALV
QLYELYRSGYTWVVQEMEYALRALEKDPQADLSGLFRDEVFAVSPKKTISPKTLGQREYL
QALRTNDLTFGIGPAGTGKTYLAVAMAVSFLLQRKVKRLILTRPAVEAGEKLGFLPGDMM
EKVNPYLRPLYDALHDMLDFRKVREMLEGGVIEVAPLAFMRGRTLNDAVVILDEAQNTTP
EQMKMFLTRMGFGSKAVVTGDVTQIDLPARTQSGLIQALKILQGVQGIGVVHFGDEDVIR
HSLVGRIVQAYDRYNRELQTDSDQST
Download sequence
Identical sequences C8X3M0
gi|258405853|ref|YP_003198595.1| WP_015752160.1.45754 485915.Dret_1733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]