SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 485916.Dtox_3101 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485916.Dtox_3101
Domain Number 1 Region: 305-464
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.08e-33
Family HD domain 0.014
Further Details:      
 
Domain Number 2 Region: 201-295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 485916.Dtox_3101
Sequence length 511
Comment (Desulfotomaculum acetoxidans DSM 771)
Sequence
MFENLLIALPAAVVAFIIGYFIRRYVVEAKIATAEEEVKRIIDNAEKTAESLKREAILEA
KEEVLKQRNEVERENKERRSELQRLERRLVQKEETLDRKTEAIEKKEDSLIKKENEIDIV
KTEIGEIYNRQLSELERISGMTSEEARQILLSDIEKEMKHEAAILIKDIETKAKEEGEKR
ARAIISLAIQRCAADHVAETTVAVIPLPNDEMKGRIIGREGRNIRAFETLTGIDLIIDDT
PEAVILSGFDPIRRETARIALEKLIVDGRIHPARIEEMVEKARKEVDFQIRDAGEQSTFD
TGVHGIHPELINLLGRLKFRTSYGQNVLKHSIEVAHLAGMMASELGVDVKLAKRAGLLHD
IGKAMDHEVEGPHVTIGVDLAKKYRESQEVIHAIASHHGDEEPKTIIAVLVQAADAISAA
RPGARRETLESYIKRLHKLEEIANSFEGVEKSFAIQAGREIRIMVHPDKVDDLGAVRLVR
DITKQIENDLDYPGQIKVVIIRETRVIDYAK
Download sequence
Identical sequences C8W3R7
485916.Dtox_3101 WP_015758545.1.30109 gi|258516254|ref|YP_003192476.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]