SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 485918.Cpin_1131 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485918.Cpin_1131
Domain Number 1 Region: 131-214
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 9.55e-16
Family Carboxypeptidase regulatory domain 0.033
Further Details:      
 
Weak hits

Sequence:  485918.Cpin_1131
Domain Number - Region: 11-42
Classification Level Classification E-value
Superfamily HMG-box 0.00088
Family HMG-box 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 485918.Cpin_1131
Sequence length 236
Comment (Chitinophaga pinensis DSM 2588)
Sequence
MKHTAPFTLHIPKPCSENWNQMTPDEKGRFCQHCQEVVVDFSAMSDQEIAGYLSNTSGKT
CGKFLPEQLNRGIGAPASNRKPVISIAAMLSALYLFLPEAKASLRPLTEQGTKPLADTSR
KKEKPVQLISEINGTILDDENEVLPGATVIIKGTRTGTRTDADGHFHLRLPEPGATYLTL
VITYVGFETKEVKVTRPHKNLRIRLDTRTMVLGEYAIVQEKSIWQHLADKVKMMLS
Download sequence
Identical sequences C7PMT5
gi|256420177|ref|YP_003120830.1| 485918.Cpin_1131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]