SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 485918.Cpin_3273 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485918.Cpin_3273
Domain Number 1 Region: 5-111
Classification Level Classification E-value
Superfamily Globin-like 1.69e-22
Family Truncated hemoglobin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 485918.Cpin_3273
Sequence length 130
Comment (Chitinophaga pinensis DSM 2588)
Sequence
MKKDITTTEDIQLLVNTFYSRVRENEILGYVFDDVAQVNWEKHLPVMHSFWATVLFGRAS
FKGNPLAKHTALHERVPLTEEHFATWLVLWHETIDELFDGKVAQSAKSKAELMKILMLGK
IQQLNTANAV
Download sequence
Identical sequences C7PRU6
WP_012790916.1.2976 485918.Cpin_3273 gi|256422288|ref|YP_003122941.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]