SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 485918.Cpin_6517 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485918.Cpin_6517
Domain Number 1 Region: 296-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-47
Family Ribonuclease PH domain 1-like 0.0000564
Further Details:      
 
Domain Number 2 Region: 14-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-44
Family Ribonuclease PH domain 1-like 0.0000614
Further Details:      
 
Domain Number 3 Region: 452-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.99e-27
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 4 Region: 140-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.82e-21
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 5 Region: 616-702
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.25e-19
Family Cold shock DNA-binding domain-like 0.0021
Further Details:      
 
Domain Number 6 Region: 556-635
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000121
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 7 Region: 242-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000017
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 485918.Cpin_6517
Sequence length 793
Comment (Chitinophaga pinensis DSM 2588)
Sequence
MNLTPISVNFDIGDGRIVTIETGKLARQADGAVTVRLGNCILLATVVAAKTPKPGQSFFP
LTVDYQEKFASAGRIPGSFFKREGKLSDYEVLISRLIDRALRPLFPDDYFCEVQVLVSLI
SSDPEVMPDALACLAASAALAVSDVPIQEIISEVRVSRIDGQLVINPNRTPLEKADMDFI
IGATEKNIMMVEGESKECSEEDIIKAIEVAHEAIRVQVKAQEELREKAGVSGKREFEKPY
ANEELKAKIAAFAQERILAVAKSASAKHDRADAFDKISEELVEHLGELPEEDAPLVGKYF
HSLEKEVIRNMILDQSVRLDGRSLDQVRPLAMETDILPSPHGSALFTRGETQSLTTVTLG
TPDDELLSESAATSKYTKFILHYNFPPFSTGEVKPMRGPGRREVGHGNLAMRSLKQMMPG
SEYAYTVRVVSDILESNGSSSMATVCAGSLALMDAGVPLPKHVSGVAMGLISRASDGKWA
VLTDILGDEDHLGDMDFKVTGTRDGICGIQMDIKVDGLSMDVMRKALEQARSGRLHIIDA
MYTAMPAARPEPKPHAPRMEKLIIDREFIGAVIGPGGKVIQEIQRETGTNINIEEVGETG
EVSIFSAQKEGLMKALEWIKGIVAVPEIGETYESTVKSVMPYGAFVEFLPGKQGLLHISE
VSWKRLETMEGVLTEGEKVKVKLVGTDPKTGKFKLSRRVLMPKPEGYVERPEGDRGDRGD
RGDRGDRGDRGDRGDRGGRPPFRGDRNDRGGDRGGDRGDRRGPRDGGDSRGDRGPRFTPP
ETETPQEPMFDEE
Download sequence
Identical sequences C7PL11
WP_012794084.1.2976 485918.Cpin_6517 gi|256425469|ref|YP_003126122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]