SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 485918.Cpin_7243 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485918.Cpin_7243
Domain Number 1 Region: 308-470
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.69e-25
Family HD domain 0.039
Further Details:      
 
Domain Number 2 Region: 208-298
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000323
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 485918.Cpin_7243
Sequence length 521
Comment (Chitinophaga pinensis DSM 2588)
Sequence
MEVTLISTIAAVVALIIGILLGKVIFAKNTQHKIQEAELQAQKIVAEGQLTAENLKKDRL
LEAKEKFLQLKSEHEKEVLQRNQKIADSENRIKQKEQSLNQKTENIQKQTQENEAIKENL
TRQMELVAVKRTELEKHQEEHIRRLEKVAALTAEEARHQLIESLKEEARSQALAHIQEII
EDAKLKANKEAKKIIIQSIQRTAAEQTIENAITVFNLESDEIKGQIIGREGRNIRAIEAA
TGVDLIVDDTPEAIVLSSFDPLRREIARLSLQRLVQDGRIHPARIEEVVEKTKKQLEEQV
MDIGERTVIELGIHGLHKELIRLVGKMRFRSSYGQNLLMHSKETANLCAVMAAELGLNPK
LAKRAGLLHDIGKVPDEETELSHALLGAKLAEKYGEHAAVVNAIGAHHDEMEMQYVISPI
IQACDAISGARPGARREIMQSYLQRIKDLENLAIAHDGVEKAYAIQAGRELRVIVESDKV
TDNDADRLSFEIANKIQTEMQYPGQIKVTVIREKRSVNVAR
Download sequence
Identical sequences C7PU48
gi|256426191|ref|YP_003126844.1| 485918.Cpin_7243 WP_012794806.1.2976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]