SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 486410.SDEG_0259 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  486410.SDEG_0259
Domain Number 1 Region: 7-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.09e-44
Family Ribonuclease PH domain 1-like 0.0000396
Further Details:      
 
Domain Number 2 Region: 297-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.32e-41
Family Ribonuclease PH domain 1-like 0.00000976
Further Details:      
 
Domain Number 3 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.14e-29
Family Ribonuclease PH domain 2-like 0.002
Further Details:      
 
Domain Number 4 Region: 453-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.44e-29
Family Ribonuclease PH domain 2-like 0.0000843
Further Details:      
 
Domain Number 5 Region: 623-707
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.5e-21
Family Cold shock DNA-binding domain-like 0.00099
Further Details:      
 
Domain Number 6 Region: 559-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.23e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 7 Region: 236-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000628
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 486410.SDEG_0259
Sequence length 714
Comment (Streptococcus dysgalactiae equisimilis GGS 124)
Sequence
MSKQTFTTTFAGKPLVVEVGQVAKQANGATVVRYGESTVLTAAVMSKKMATGDFFPLQVN
YEEKMYAAGKFPGGFMKREGRPSTDATLTARLIDRPIRPMFAEGFRNEVQVINTVLSYDE
NASAPMAAMFGSSLALSISDIPFNGPIAGVQVGYIDGEFIINPDKEQMEASLLELTVAGS
KEAINMVESGAKELSEDIMLEALLKGHQAIQELIAFQEQIVAVVGKEKAEVELLQVDADL
QADIVAKYNAQLQKAVQVEEKKAREAATEAVKEMVKAEYEERYAEDENLATIMRDVAEIL
EQMEHAEVRRLITEDKIRPDGRKIDEIRPLDAEVDFLPKVHGLGLFTRGQTQALSVLTLA
PMGETQIIDGLAPEYKKRFLHHYNFPQYSVGETGRYGAAGRREIGHGALGERALEQVLPS
LEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGVPIKAPVAGIAMGLISDGTNYTV
LTDIQGLEDHFGDMDFKVAGTREGITALQMDIKIAGITPQILEEALAQAKKARFEILDVI
EETIAEPRPELAPTAPKIDTIKIDVDKIKVVIGKGGETIDKIIAETGVKIDIDDEGNVSI
YSSDQAAIDRTKEIIAGLVREAKVGEVYHAKVVRIEKFGAFVNLFDKTDALVHISEIAWT
RTTNVSDVLEVGEDVDVKVIKIDEKGRVDASMKALIPRPPKPEKKEMKKEENHD
Download sequence
Identical sequences C5WEG1
gi|251781688|ref|YP_002995990.1| WP_012766528.1.34645 486410.SDEG_0259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]