SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 488221.SP70585_0652 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  488221.SP70585_0652
Domain Number 1 Region: 8-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.8e-46
Family Ribonuclease PH domain 1-like 0.0000328
Further Details:      
 
Domain Number 2 Region: 297-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.94e-43
Family Ribonuclease PH domain 1-like 0.00000786
Further Details:      
 
Domain Number 3 Region: 453-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.76e-29
Family Ribonuclease PH domain 2-like 0.0000925
Further Details:      
 
Domain Number 4 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.4e-28
Family Ribonuclease PH domain 2-like 0.0017
Further Details:      
 
Domain Number 5 Region: 559-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.36e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 6 Region: 616-697
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4e-21
Family Cold shock DNA-binding domain-like 0.0012
Further Details:      
 
Domain Number 7 Region: 236-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000628
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 488221.SP70585_0652
Sequence length 737
Comment (Streptococcus pneumoniae 70585)
Sequence
MAKQVFQTTFAGRELIVETGQVAKQANGSVVVRYGESTVLTAAVMSKKMATGDFFPLQVN
YEEKMYAAGKFPGGFMKREGRPSTDATLTARLIDRPIRPMFAEGFRNEVQVINTVLSYDE
NASAPMAAMFGSSLALSISDIPFDGPIAGVQVGYVDGQIIINPSQEQAEQSLLELTVAGT
KHAINMVESGAKELSEEIMLEALLKGHEAVKELIAFQEEIVAAVGKEKAEVELLHVDAEL
QAEIIAAYNSDLQKAVQVEEKLAREAATQAVKDQVTAVYEEKYANHEEFDRIMRDVAEIL
EQMEHAEVRRLITEDKVRPDGRKVDEIRPLDAVVDFLPRVHGSGLFTRGQTQALSVLTLA
PMGETQIIDGLDPEYKKRFMHHYNFPQYSVGETGRYGAPGRREIGHGALGERALAQVLPS
LEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGVPIKAPVAGIAMGLISDGNNYTV
LTDIQGLEDHFGDMDFKVAGTRDGITALQMDIKIQGITAEILTEALAQAKKARFEILDVI
EATIPEVRPELAPTAPKIDTIKIDVDKIKIVIGKGGETIDKIIAETGVKIDIDEEGNVSI
YSSDQDAINRAKEIIAGLVREAKVDEVYRAKVVRIEKFGAFVNLFDKTDALVHISEMAWT
RTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKALLPRPPKPEHDEKGEKSERPHRPRHH
KDHKPKKEFTETPKDSE
Download sequence
Identical sequences A0A0T9ZWW6 C1C5V9
gi|225858425|ref|YP_002739935.1| 488221.SP70585_0652 WP_001118976.1.100026 WP_001118976.1.10049 WP_001118976.1.100756 WP_001118976.1.101219 WP_001118976.1.10613 WP_001118976.1.11289 WP_001118976.1.11872 WP_001118976.1.11922 WP_001118976.1.13100 WP_001118976.1.13388 WP_001118976.1.14131 WP_001118976.1.14435 WP_001118976.1.14784 WP_001118976.1.15106 WP_001118976.1.15135 WP_001118976.1.16568 WP_001118976.1.16570 WP_001118976.1.16630 WP_001118976.1.1684 WP_001118976.1.16886 WP_001118976.1.17630 WP_001118976.1.17652 WP_001118976.1.17826 WP_001118976.1.17854 WP_001118976.1.18488 WP_001118976.1.18630 WP_001118976.1.18768 WP_001118976.1.19003 WP_001118976.1.19383 WP_001118976.1.19586 WP_001118976.1.20298 WP_001118976.1.20681 WP_001118976.1.20766 WP_001118976.1.20981 WP_001118976.1.21394 WP_001118976.1.21435 WP_001118976.1.21605 WP_001118976.1.21675 WP_001118976.1.21691 WP_001118976.1.21790 WP_001118976.1.22043 WP_001118976.1.22297 WP_001118976.1.22637 WP_001118976.1.22717 WP_001118976.1.22839 WP_001118976.1.22938 WP_001118976.1.23097 WP_001118976.1.23432 WP_001118976.1.23798 WP_001118976.1.24060 WP_001118976.1.2459 WP_001118976.1.24724 WP_001118976.1.24871 WP_001118976.1.25754 WP_001118976.1.25785 WP_001118976.1.26165 WP_001118976.1.26432 WP_001118976.1.26625 WP_001118976.1.26725 WP_001118976.1.26926 WP_001118976.1.26983 WP_001118976.1.26985 WP_001118976.1.27347 WP_001118976.1.2791 WP_001118976.1.27917 WP_001118976.1.28068 WP_001118976.1.28307 WP_001118976.1.28353 WP_001118976.1.28986 WP_001118976.1.29357 WP_001118976.1.29687 WP_001118976.1.29828 WP_001118976.1.3008 WP_001118976.1.30295 WP_001118976.1.30588 WP_001118976.1.30942 WP_001118976.1.31333 WP_001118976.1.31989 WP_001118976.1.32876 WP_001118976.1.33788 WP_001118976.1.34028 WP_001118976.1.34047 WP_001118976.1.34262 WP_001118976.1.34335 WP_001118976.1.34651 WP_001118976.1.34713 WP_001118976.1.35103 WP_001118976.1.35232 WP_001118976.1.35702 WP_001118976.1.36486 WP_001118976.1.36750 WP_001118976.1.36789 WP_001118976.1.36993 WP_001118976.1.37118 WP_001118976.1.37301 WP_001118976.1.37415 WP_001118976.1.38213 WP_001118976.1.38216 WP_001118976.1.39097 WP_001118976.1.39985 WP_001118976.1.40826 WP_001118976.1.4094 WP_001118976.1.41010 WP_001118976.1.4128 WP_001118976.1.41801 WP_001118976.1.41902 WP_001118976.1.42121 WP_001118976.1.42140 WP_001118976.1.424 WP_001118976.1.42825 WP_001118976.1.43046 WP_001118976.1.43289 WP_001118976.1.43302 WP_001118976.1.43467 WP_001118976.1.43580 WP_001118976.1.43634 WP_001118976.1.44019 WP_001118976.1.44024 WP_001118976.1.4409 WP_001118976.1.44293 WP_001118976.1.44379 WP_001118976.1.44462 WP_001118976.1.44789 WP_001118976.1.45023 WP_001118976.1.45082 WP_001118976.1.4556 WP_001118976.1.4566 WP_001118976.1.47076 WP_001118976.1.47180 WP_001118976.1.47342 WP_001118976.1.47771 WP_001118976.1.48171 WP_001118976.1.48511 WP_001118976.1.49008 WP_001118976.1.49324 WP_001118976.1.49538 WP_001118976.1.49635 WP_001118976.1.50120 WP_001118976.1.50436 WP_001118976.1.50664 WP_001118976.1.50824 WP_001118976.1.50948 WP_001118976.1.51533 WP_001118976.1.51684 WP_001118976.1.52108 WP_001118976.1.52896 WP_001118976.1.5385 WP_001118976.1.5396 WP_001118976.1.54130 WP_001118976.1.54214 WP_001118976.1.54349 WP_001118976.1.54792 WP_001118976.1.55479 WP_001118976.1.55499 WP_001118976.1.55525 WP_001118976.1.55763 WP_001118976.1.5578 WP_001118976.1.56581 WP_001118976.1.56582 WP_001118976.1.57917 WP_001118976.1.5793 WP_001118976.1.58171 WP_001118976.1.59527 WP_001118976.1.60601 WP_001118976.1.6128 WP_001118976.1.61372 WP_001118976.1.61651 WP_001118976.1.61954 WP_001118976.1.62006 WP_001118976.1.62190 WP_001118976.1.62197 WP_001118976.1.62235 WP_001118976.1.62420 WP_001118976.1.62518 WP_001118976.1.62558 WP_001118976.1.62559 WP_001118976.1.62613 WP_001118976.1.6309 WP_001118976.1.63245 WP_001118976.1.63971 WP_001118976.1.64359 WP_001118976.1.6478 WP_001118976.1.64837 WP_001118976.1.64867 WP_001118976.1.64913 WP_001118976.1.65235 WP_001118976.1.65368 WP_001118976.1.65859 WP_001118976.1.66517 WP_001118976.1.66685 WP_001118976.1.67039 WP_001118976.1.67151 WP_001118976.1.67885 WP_001118976.1.68077 WP_001118976.1.68103 WP_001118976.1.68306 WP_001118976.1.68622 WP_001118976.1.6894 WP_001118976.1.69057 WP_001118976.1.69211 WP_001118976.1.69531 WP_001118976.1.69668 WP_001118976.1.69695 WP_001118976.1.69954 WP_001118976.1.70064 WP_001118976.1.70486 WP_001118976.1.70771 WP_001118976.1.70802 WP_001118976.1.71177 WP_001118976.1.71571 WP_001118976.1.71879 WP_001118976.1.72309 WP_001118976.1.72854 WP_001118976.1.7347 WP_001118976.1.73568 WP_001118976.1.74220 WP_001118976.1.74231 WP_001118976.1.74537 WP_001118976.1.74633 WP_001118976.1.75094 WP_001118976.1.75142 WP_001118976.1.75203 WP_001118976.1.75325 WP_001118976.1.75558 WP_001118976.1.76393 WP_001118976.1.76458 WP_001118976.1.76764 WP_001118976.1.77121 WP_001118976.1.78129 WP_001118976.1.78832 WP_001118976.1.78887 WP_001118976.1.7910 WP_001118976.1.79675 WP_001118976.1.79705 WP_001118976.1.79793 WP_001118976.1.79811 WP_001118976.1.80134 WP_001118976.1.80516 WP_001118976.1.81296 WP_001118976.1.81473 WP_001118976.1.81962 WP_001118976.1.82159 WP_001118976.1.82481 WP_001118976.1.82971 WP_001118976.1.83055 WP_001118976.1.83934 WP_001118976.1.83978 WP_001118976.1.8398 WP_001118976.1.84080 WP_001118976.1.85212 WP_001118976.1.86238 WP_001118976.1.8708 WP_001118976.1.87421 WP_001118976.1.8744 WP_001118976.1.87521 WP_001118976.1.87731 WP_001118976.1.87792 WP_001118976.1.87872 WP_001118976.1.8799 WP_001118976.1.88254 WP_001118976.1.89057 WP_001118976.1.8970 WP_001118976.1.90234 WP_001118976.1.9027 WP_001118976.1.90501 WP_001118976.1.90502 WP_001118976.1.90577 WP_001118976.1.91015 WP_001118976.1.91024 WP_001118976.1.91099 WP_001118976.1.91271 WP_001118976.1.92389 WP_001118976.1.92640 WP_001118976.1.92732 WP_001118976.1.9297 WP_001118976.1.93285 WP_001118976.1.9332 WP_001118976.1.93442 WP_001118976.1.94024 WP_001118976.1.94104 WP_001118976.1.94316 WP_001118976.1.94503 WP_001118976.1.95219 WP_001118976.1.95707 WP_001118976.1.95936 WP_001118976.1.96024 WP_001118976.1.96081 WP_001118976.1.96231 WP_001118976.1.96564 WP_001118976.1.96652 WP_001118976.1.96694 WP_001118976.1.96851 WP_001118976.1.97035 WP_001118976.1.97485 WP_001118976.1.97582 WP_001118976.1.97866 WP_001118976.1.98399 WP_001118976.1.99114 WP_001118976.1.99356 WP_001118976.1.99451 WP_001118976.1.99685 WP_001118976.1.99839 WP_001118976.1.99900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]