SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 488222.SPJ_0856 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  488222.SPJ_0856
Domain Number - Region: 57-114
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0785
Family DBL homology domain (DH-domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 488222.SPJ_0856
Sequence length 156
Comment (Streptococcus pneumoniae JJA)
Sequence
MLIKEFAKSLSLRKTKTNKKDAHGIALKLLSDPNREQFQHDNRQVELKILTRHIHRLKKK
QSDWKVQYTRCLDIIFPELDKIVGKHSEYTYQLLTRYPNPQKRIEAGFDKLIEIKRLTAS
NSRAFCRALKSSPNHQIEIRNSLDKTIDFSYSLSFS
Download sequence
Identical sequences A0A0T7KJH7 B2IP75 C1CDR4
gi|182683864|ref|YP_001835611.1| 488222.SPJ_0856 516950.SPCG_0894 gi|225854423|ref|YP_002735935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]