SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 488222.SPJ_1635 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  488222.SPJ_1635
Domain Number 1 Region: 333-484
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.47e-29
Family HD domain 0.026
Further Details:      
 
Domain Number 2 Region: 227-321
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.82e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 488222.SPJ_1635
Sequence length 537
Comment (Streptococcus pneumoniae JJA)
Sequence
MEIMSLAIAVFAVIIGLVIGYVSISAKMKSSQEAAELMLLNAEQEATNLRGQAEREADLL
VNEAKRESKSLKKEALLEAKEEARKYREEVDAEFKSERQELKQIESRLTERATSLDRKDD
NLTSKEQTLEQKEQSISDRAKNLDAREEQLEEVERQKEAELERIGALSQAEARDIILAQT
EENLTREIASRIREAEQEVKERSDKMAKDILVQAMQRIAGEYVAESTNSTVHLPDDTMKG
RIIGREGRNIRTFESLTGVDVIIDDTPEVVTLSGFDPIRREIARMTMEMLLKDGRIHPAR
IEELVEKNRQEIDNKIREYGEAAAYEIGAPNLHPDLMKIMGRLQFRTSYGQNVLRHSIEV
AKLAGIMASELGENAALARRAGFLHDIGKAIDHEVEGSHVEIGMELARKYKEPPVVVNTI
ASHHGDVEAESVIAVIVAAADALSAARPGARSESLESYIKRLHDLEEIANGFEGVQTSFA
LQAGREIRIMVNPGKIKDDKVTILAHKVRKKIENNLDYPGNIKVTVIRELRAVDYAK
Download sequence
Identical sequences A0A0B7MCC6 A5LN71 B1I7K2 B2IS90 C1C8X6 C1CFW1 G6JCI2 G6LPJ3 J1NWB1 M5K7P5 M5KI27 M5MZR7 Q04J36
gi|480537176|ref|YP_007815085.1| gi|225857352|ref|YP_002738863.1| gi|307068364|ref|YP_003877330.1| gi|480531733|ref|YP_007763937.1| gi|225855170|ref|YP_002736682.1| gi|410477108|ref|YP_006743867.1| gi|182684683|ref|YP_001836430.1| gi|387626928|ref|YP_006063104.1| gi|15903626|ref|NP_359176.1| gi|387757955|ref|YP_006064934.1| gi|480532731|ref|YP_007764934.1| gi|307127953|ref|YP_003879984.1| NP_359176.1.60829 WP_000404940.1.10 WP_000404940.1.100001 WP_000404940.1.100011 WP_000404940.1.100012 WP_000404940.1.100026 WP_000404940.1.100033 WP_000404940.1.100039 WP_000404940.1.100048 WP_000404940.1.100102 WP_000404940.1.100114 WP_000404940.1.100140 WP_000404940.1.100153 WP_000404940.1.10016 WP_000404940.1.100164 WP_000404940.1.100168 WP_000404940.1.100169 WP_000404940.1.100186 WP_000404940.1.100192 WP_000404940.1.100197 WP_000404940.1.10020 WP_000404940.1.100263 WP_000404940.1.100289 WP_000404940.1.100325 WP_000404940.1.100339 WP_000404940.1.100341 WP_000404940.1.100364 WP_000404940.1.100369 WP_000404940.1.100477 WP_000404940.1.10049 WP_000404940.1.100516 WP_000404940.1.100529 WP_000404940.1.100532 WP_000404940.1.100540 WP_000404940.1.100547 WP_000404940.1.100569 WP_000404940.1.100579 WP_000404940.1.10060 WP_000404940.1.100627 WP_000404940.1.100634 WP_000404940.1.100640 WP_000404940.1.100679 WP_000404940.1.100681 WP_000404940.1.100734 WP_000404940.1.100745 WP_000404940.1.100756 WP_000404940.1.100805 WP_000404940.1.100816 WP_000404940.1.100818 WP_000404940.1.100829 WP_000404940.1.100839 WP_000404940.1.100848 WP_000404940.1.100855 WP_000404940.1.100863 WP_000404940.1.100874 WP_000404940.1.100885 WP_000404940.1.100911 WP_000404940.1.100914 WP_000404940.1.100937 WP_000404940.1.100940 WP_000404940.1.100947 WP_000404940.1.100997 WP_000404940.1.10103 WP_000404940.1.101044 WP_000404940.1.101061 WP_000404940.1.101066 WP_000404940.1.101080 WP_000404940.1.101092 WP_000404940.1.101098 WP_000404940.1.101106 WP_000404940.1.101116 WP_000404940.1.101127 WP_000404940.1.101135 WP_000404940.1.101167 WP_000404940.1.101176 WP_000404940.1.101178 WP_000404940.1.10118 WP_000404940.1.101201 WP_000404940.1.101205 WP_000404940.1.101213 WP_000404940.1.101215 WP_000404940.1.101219 WP_000404940.1.10122 WP_000404940.1.101232 WP_000404940.1.101250 WP_000404940.1.101256 WP_000404940.1.101260 WP_000404940.1.101274 WP_000404940.1.101286 WP_000404940.1.101287 WP_000404940.1.101315 WP_000404940.1.101373 WP_000404940.1.101394 WP_000404940.1.101407 WP_000404940.1.101410 WP_000404940.1.101435 WP_000404940.1.101438 WP_000404940.1.101455 WP_000404940.1.101457 WP_000404940.1.101464 WP_000404940.1.101484 WP_000404940.1.101489 WP_000404940.1.101497 WP_000404940.1.101500 WP_000404940.1.101517 WP_000404940.1.10153 WP_000404940.1.101537 WP_000404940.1.101560 WP_000404940.1.101577 WP_000404940.1.101595 WP_000404940.1.101599 WP_000404940.1.101614 WP_000404940.1.101649 WP_000404940.1.101685 WP_000404940.1.10169 WP_000404940.1.1017 WP_000404940.1.101709 WP_000404940.1.101729 WP_000404940.1.101738 WP_000404940.1.101746 WP_000404940.1.10175 WP_000404940.1.101750 WP_000404940.1.101763 WP_000404940.1.101765 WP_000404940.1.101784 WP_000404940.1.101789 WP_000404940.1.101801 WP_000404940.1.101803 WP_000404940.1.101806 WP_000404940.1.10183 WP_000404940.1.101842 WP_000404940.1.101847 WP_000404940.1.101857 WP_000404940.1.101875 WP_000404940.1.10192 WP_000404940.1.10196 WP_000404940.1.101974 WP_000404940.1.101988 WP_000404940.1.102006 WP_000404940.1.102077 WP_000404940.1.102086 WP_000404940.1.102114 WP_000404940.1.102115 WP_000404940.1.102129 WP_000404940.1.102134 WP_000404940.1.102141 WP_000404940.1.10221 WP_000404940.1.1026 WP_000404940.1.10261 WP_000404940.1.10284 WP_000404940.1.10295 WP_000404940.1.10314 WP_000404940.1.10316 WP_000404940.1.10337 WP_000404940.1.1034 WP_000404940.1.10364 WP_000404940.1.10367 WP_000404940.1.10426 WP_000404940.1.10434 WP_000404940.1.10449 WP_000404940.1.10458 WP_000404940.1.10494 WP_000404940.1.10499 WP_000404940.1.1050 WP_000404940.1.10500 WP_000404940.1.10504 WP_000404940.1.10515 WP_000404940.1.10546 WP_000404940.1.10571 WP_000404940.1.10574 WP_000404940.1.10585 WP_000404940.1.10591 WP_000404940.1.10599 WP_000404940.1.10613 WP_000404940.1.10619 WP_000404940.1.10622 WP_000404940.1.1068 WP_000404940.1.10683 WP_000404940.1.1069 WP_000404940.1.10692 WP_000404940.1.1070 WP_000404940.1.10708 WP_000404940.1.10713 WP_000404940.1.10731 WP_000404940.1.10747 WP_000404940.1.1076 WP_000404940.1.10760 WP_000404940.1.10819 WP_000404940.1.10820 WP_000404940.1.10827 WP_000404940.1.1083 WP_000404940.1.1091 WP_000404940.1.10910 WP_000404940.1.10914 WP_000404940.1.10932 WP_000404940.1.10933 WP_000404940.1.10934 WP_000404940.1.10937 WP_000404940.1.10948 WP_000404940.1.10952 WP_000404940.1.10987 WP_000404940.1.11 WP_000404940.1.11007 WP_000404940.1.11027 WP_000404940.1.11043 WP_000404940.1.11045 WP_000404940.1.11079 WP_000404940.1.11085 WP_000404940.1.11093 WP_000404940.1.11099 WP_000404940.1.11102 WP_000404940.1.11103 WP_000404940.1.11131 WP_000404940.1.11139 WP_000404940.1.11144 WP_000404940.1.11151 WP_000404940.1.11154 WP_000404940.1.11197 WP_000404940.1.11205 WP_000404940.1.11243 WP_000404940.1.11260 WP_000404940.1.11279 WP_000404940.1.11297 WP_000404940.1.11298 WP_000404940.1.11299 WP_000404940.1.11311 WP_000404940.1.11319 WP_000404940.1.11328 WP_000404940.1.11337 WP_000404940.1.11358 WP_000404940.1.11383 WP_000404940.1.11409 WP_000404940.1.11413 WP_000404940.1.11425 WP_000404940.1.11439 WP_000404940.1.11448 WP_000404940.1.11474 WP_000404940.1.11486 WP_000404940.1.11495 WP_000404940.1.11509 WP_000404940.1.11510 WP_000404940.1.11517 WP_000404940.1.11537 WP_000404940.1.11563 WP_000404940.1.11570 WP_000404940.1.11573 WP_000404940.1.11594 WP_000404940.1.11617 WP_000404940.1.11624 WP_000404940.1.1165 WP_000404940.1.11657 WP_000404940.1.11664 WP_000404940.1.11669 WP_000404940.1.11682 WP_000404940.1.11706 WP_000404940.1.11711 WP_000404940.1.11760 WP_000404940.1.1178 WP_000404940.1.11792 WP_000404940.1.11811 WP_000404940.1.11823 WP_000404940.1.11849 WP_000404940.1.11858 WP_000404940.1.11861 WP_000404940.1.11871 WP_000404940.1.11902 WP_000404940.1.1192 WP_000404940.1.11922 WP_000404940.1.11931 WP_000404940.1.11935 WP_000404940.1.11950 WP_000404940.1.11967 WP_000404940.1.1201 WP_000404940.1.12023 WP_000404940.1.12024 WP_000404940.1.12034 WP_000404940.1.12044 WP_000404940.1.12046 WP_000404940.1.12062 WP_000404940.1.12068 WP_000404940.1.12085 WP_000404940.1.12099 WP_000404940.1.12113 WP_000404940.1.12125 WP_000404940.1.12131 WP_000404940.1.12134 WP_000404940.1.12140 WP_000404940.1.12154 WP_000404940.1.12182 WP_000404940.1.12186 WP_000404940.1.12198 WP_000404940.1.12222 WP_000404940.1.12225 WP_000404940.1.12238 WP_000404940.1.1230 WP_000404940.1.12306 WP_000404940.1.12307 WP_000404940.1.12312 WP_000404940.1.1233 WP_000404940.1.12336 WP_000404940.1.12339 WP_000404940.1.12378 WP_000404940.1.124 WP_000404940.1.12407 WP_000404940.1.12413 WP_000404940.1.12427 WP_000404940.1.12428 WP_000404940.1.12429 WP_000404940.1.12430 WP_000404940.1.12435 WP_000404940.1.12440 WP_000404940.1.12443 WP_000404940.1.12444 WP_000404940.1.12450 WP_000404940.1.12470 WP_000404940.1.12487 WP_000404940.1.12492 WP_000404940.1.12494 WP_000404940.1.12506 WP_000404940.1.12524 WP_000404940.1.12543 WP_000404940.1.12570 WP_000404940.1.12573 WP_000404940.1.12578 WP_000404940.1.1258 WP_000404940.1.12580 WP_000404940.1.12588 WP_000404940.1.12595 WP_000404940.1.12613 WP_000404940.1.1262 WP_000404940.1.12651 WP_000404940.1.12673 WP_000404940.1.12677 WP_000404940.1.12681 WP_000404940.1.12723 WP_000404940.1.12754 WP_000404940.1.12765 WP_000404940.1.12777 WP_000404940.1.12786 WP_000404940.1.128 WP_000404940.1.12805 WP_000404940.1.12813 WP_000404940.1.1282 WP_000404940.1.12859 WP_000404940.1.12866 WP_000404940.1.1288 WP_000404940.1.12898 WP_000404940.1.12948 WP_000404940.1.12952 WP_000404940.1.12958 WP_000404940.1.12963 WP_000404940.1.12966 WP_000404940.1.12996 WP_000404940.1.13000 WP_000404940.1.1302 WP_000404940.1.13023 WP_000404940.1.13032 WP_000404940.1.13033 WP_000404940.1.13036 WP_000404940.1.13048 WP_000404940.1.13065 WP_000404940.1.13099 WP_000404940.1.13100 WP_000404940.1.13119 WP_000404940.1.13121 WP_000404940.1.13123 WP_000404940.1.13152 WP_000404940.1.13168 WP_000404940.1.13209 WP_000404940.1.13229 WP_000404940.1.13245 WP_000404940.1.13256 WP_000404940.1.1328 WP_000404940.1.13286 WP_000404940.1.1330 WP_000404940.1.13310 WP_000404940.1.13324 WP_000404940.1.13327 WP_000404940.1.13328 WP_000404940.1.13330 WP_000404940.1.13331 WP_000404940.1.13340 WP_000404940.1.13351 WP_000404940.1.13382 WP_000404940.1.13388 WP_000404940.1.13390 WP_000404940.1.1348 WP_000404940.1.135 WP_000404940.1.13515 WP_000404940.1.13527 WP_000404940.1.13537 WP_000404940.1.13565 WP_000404940.1.13570 WP_000404940.1.13581 WP_000404940.1.13584 WP_000404940.1.13590 WP_000404940.1.13604 WP_000404940.1.13607 WP_000404940.1.13629 WP_000404940.1.13643 WP_000404940.1.1368 WP_000404940.1.13682 WP_000404940.1.13692 WP_000404940.1.13701 WP_000404940.1.13705 WP_000404940.1.13710 WP_000404940.1.13729 WP_000404940.1.13736 WP_000404940.1.13738 WP_000404940.1.13745 WP_000404940.1.13845 WP_000404940.1.13854 WP_000404940.1.13886 WP_000404940.1.139 WP_000404940.1.13903 WP_000404940.1.1391 WP_000404940.1.13917 WP_000404940.1.13954 WP_000404940.1.13958 WP_000404940.1.13989 WP_000404940.1.1399 WP_000404940.1.13997 WP_000404940.1.13998 WP_000404940.1.13999 WP_000404940.1.14012 WP_000404940.1.14033 WP_000404940.1.14051 WP_000404940.1.14060 WP_000404940.1.14066 WP_000404940.1.14102 WP_000404940.1.14107 WP_000404940.1.14126 WP_000404940.1.14131 WP_000404940.1.14132 WP_000404940.1.14166 WP_000404940.1.14183 WP_000404940.1.14206 WP_000404940.1.14217 WP_000404940.1.14218 WP_000404940.1.14260 WP_000404940.1.14287 WP_000404940.1.14291 WP_000404940.1.14295 WP_000404940.1.1432 WP_000404940.1.14327 WP_000404940.1.14335 WP_000404940.1.14347 WP_000404940.1.14350 WP_000404940.1.14374 WP_000404940.1.14384 WP_000404940.1.14404 WP_000404940.1.14409 WP_000404940.1.14422 WP_000404940.1.14430 WP_000404940.1.14435 WP_000404940.1.14480 WP_000404940.1.14488 WP_000404940.1.14511 WP_000404940.1.14513 WP_000404940.1.14541 WP_000404940.1.14560 WP_000404940.1.14599 WP_000404940.1.14622 WP_000404940.1.14657 WP_000404940.1.14662 WP_000404940.1.14682 WP_000404940.1.14722 WP_000404940.1.14728 WP_000404940.1.14740 WP_000404940.1.14757 WP_000404940.1.14780 WP_000404940.1.14784 WP_000404940.1.14826 WP_000404940.1.14831 WP_000404940.1.14880 WP_000404940.1.14885 WP_000404940.1.14889 WP_000404940.1.14899 WP_000404940.1.14900 WP_000404940.1.14907 WP_000404940.1.14949 WP_000404940.1.14957 WP_000404940.1.14959 WP_000404940.1.14975 WP_000404940.1.1502 WP_000404940.1.15026 WP_000404940.1.1503 WP_000404940.1.15030 WP_000404940.1.15045 WP_000404940.1.15048 WP_000404940.1.15058 WP_000404940.1.1507 WP_000404940.1.15081 WP_000404940.1.15104 WP_000404940.1.15106 WP_000404940.1.15113 WP_000404940.1.15128 WP_000404940.1.15135 WP_000404940.1.15139 WP_000404940.1.15141 WP_000404940.1.15142 WP_000404940.1.1515 WP_000404940.1.15155 WP_000404940.1.15157 WP_000404940.1.15189 WP_000404940.1.15215 WP_000404940.1.1522 WP_000404940.1.15220 WP_000404940.1.15254 WP_000404940.1.15266 WP_000404940.1.15305 WP_000404940.1.15366 WP_000404940.1.15370 WP_000404940.1.15390 WP_000404940.1.15391 WP_000404940.1.15395 WP_000404940.1.15396 WP_000404940.1.15405 WP_000404940.1.1541 WP_000404940.1.15425 WP_000404940.1.15440 WP_000404940.1.1549 WP_000404940.1.15498 WP_000404940.1.15504 WP_000404940.1.15506 WP_000404940.1.15509 WP_000404940.1.15513 WP_000404940.1.15542 WP_000404940.1.15552 WP_000404940.1.15575 WP_000404940.1.15578 WP_000404940.1.15607 WP_000404940.1.15635 WP_000404940.1.15639 WP_000404940.1.15650 WP_000404940.1.1566 WP_000404940.1.15661 WP_000404940.1.15671 WP_000404940.1.15683 WP_000404940.1.15690 WP_000404940.1.15701 WP_000404940.1.15709 WP_000404940.1.15720 WP_000404940.1.15761 WP_000404940.1.15788 WP_000404940.1.15797 WP_000404940.1.15798 WP_000404940.1.15800 WP_000404940.1.15841 WP_000404940.1.15844 WP_000404940.1.15849 WP_000404940.1.15854 WP_000404940.1.15872 WP_000404940.1.15891 WP_000404940.1.15907 WP_000404940.1.15917 WP_000404940.1.15918 WP_000404940.1.15935 WP_000404940.1.15943 WP_000404940.1.15955 WP_000404940.1.15967 WP_000404940.1.15968 WP_000404940.1.16049 WP_000404940.1.16053 WP_000404940.1.16093 WP_000404940.1.16094 WP_000404940.1.16101 WP_000404940.1.16118 WP_000404940.1.16145 WP_000404940.1.16152 WP_000404940.1.16184 WP_000404940.1.16220 WP_000404940.1.16229 WP_000404940.1.16259 WP_000404940.1.16281 WP_000404940.1.16287 WP_000404940.1.16290 WP_000404940.1.16302 WP_000404940.1.16306 WP_000404940.1.16316 WP_000404940.1.16317 WP_000404940.1.16323 WP_000404940.1.16330 WP_000404940.1.16336 WP_000404940.1.16337 WP_000404940.1.16375 WP_000404940.1.16381 WP_000404940.1.16385 WP_000404940.1.16437 WP_000404940.1.16441 WP_000404940.1.16470 WP_000404940.1.16479 WP_000404940.1.16509 WP_000404940.1.16514 WP_000404940.1.1653 WP_000404940.1.16555 WP_000404940.1.16568 WP_000404940.1.16570 WP_000404940.1.16630 WP_000404940.1.16662 WP_000404940.1.16676 WP_000404940.1.1672 WP_000404940.1.16727 WP_000404940.1.16730 WP_000404940.1.16741 WP_000404940.1.16778 WP_000404940.1.16793 WP_000404940.1.168 WP_000404940.1.16803 WP_000404940.1.16813 WP_000404940.1.16814 WP_000404940.1.1682 WP_000404940.1.16831 WP_000404940.1.16832 WP_000404940.1.1684 WP_000404940.1.1686 WP_000404940.1.16884 WP_000404940.1.16886 WP_000404940.1.16889 WP_000404940.1.16902 WP_000404940.1.16911 WP_000404940.1.16947 WP_000404940.1.16952 WP_000404940.1.16955 WP_000404940.1.16956 WP_000404940.1.16974 WP_000404940.1.1698 WP_000404940.1.16981 WP_000404940.1.17003 WP_000404940.1.17029 WP_000404940.1.17033 WP_000404940.1.17036 WP_000404940.1.17045 WP_000404940.1.17063 WP_000404940.1.17091 WP_000404940.1.1711 WP_000404940.1.17133 WP_000404940.1.1714 WP_000404940.1.17144 WP_000404940.1.17163 WP_000404940.1.17208 WP_000404940.1.17214 WP_000404940.1.17227 WP_000404940.1.17229 WP_000404940.1.17238 WP_000404940.1.1724 WP_000404940.1.17252 WP_000404940.1.17254 WP_000404940.1.17257 WP_000404940.1.17263 WP_000404940.1.17269 WP_000404940.1.17286 WP_000404940.1.17291 WP_000404940.1.17312 WP_000404940.1.17315 WP_000404940.1.17330 WP_000404940.1.17363 WP_000404940.1.17372 WP_000404940.1.17411 WP_000404940.1.1742 WP_000404940.1.17420 WP_000404940.1.17427 WP_000404940.1.17438 WP_000404940.1.17470 WP_000404940.1.17472 WP_000404940.1.17474 WP_000404940.1.17532 WP_000404940.1.17562 WP_000404940.1.17571 WP_000404940.1.17601 WP_000404940.1.17602 WP_000404940.1.17609 WP_000404940.1.17641 WP_000404940.1.17652 WP_000404940.1.17665 WP_000404940.1.17677 WP_000404940.1.17688 WP_000404940.1.17691 WP_000404940.1.17706 WP_000404940.1.17715 WP_000404940.1.17716 WP_000404940.1.17775 WP_000404940.1.17776 WP_000404940.1.17784 WP_000404940.1.17810 WP_000404940.1.17820 WP_000404940.1.17822 WP_000404940.1.17826 WP_000404940.1.1783 WP_000404940.1.17839 WP_000404940.1.17844 WP_000404940.1.17854 WP_000404940.1.17888 WP_000404940.1.17892 WP_000404940.1.17895 WP_000404940.1.17942 WP_000404940.1.17965 WP_000404940.1.17971 WP_000404940.1.17972 WP_000404940.1.180 WP_000404940.1.18012 WP_000404940.1.18018 WP_000404940.1.18040 WP_000404940.1.18067 WP_000404940.1.18100 WP_000404940.1.18127 WP_000404940.1.18130 WP_000404940.1.18131 WP_000404940.1.18166 WP_000404940.1.18180 WP_000404940.1.18193 WP_000404940.1.18215 WP_000404940.1.18233 WP_000404940.1.18244 WP_000404940.1.18258 WP_000404940.1.1826 WP_000404940.1.18266 WP_000404940.1.18278 WP_000404940.1.18279 WP_000404940.1.18285 WP_000404940.1.18300 WP_000404940.1.18342 WP_000404940.1.18357 WP_000404940.1.184 WP_000404940.1.18404 WP_000404940.1.18415 WP_000404940.1.18417 WP_000404940.1.18423 WP_000404940.1.18449 WP_000404940.1.1846 WP_000404940.1.18464 WP_000404940.1.1848 WP_000404940.1.18488 WP_000404940.1.18514 WP_000404940.1.18528 WP_000404940.1.18534 WP_000404940.1.18555 WP_000404940.1.1856 WP_000404940.1.18571 WP_000404940.1.18572 WP_000404940.1.18619 WP_000404940.1.18630 WP_000404940.1.18634 WP_000404940.1.18638 WP_000404940.1.18644 WP_000404940.1.18652 WP_000404940.1.18670 WP_000404940.1.18687 WP_000404940.1.18712 WP_000404940.1.1872 WP_000404940.1.18733 WP_000404940.1.18764 WP_000404940.1.18768 WP_000404940.1.18770 WP_000404940.1.18771 WP_000404940.1.18773 WP_000404940.1.18831 WP_000404940.1.18864 WP_000404940.1.18869 WP_000404940.1.1887 WP_000404940.1.18884 WP_000404940.1.18894 WP_000404940.1.18903 WP_000404940.1.18928 WP_000404940.1.1894 WP_000404940.1.18946 WP_000404940.1.18948 WP_000404940.1.18951 WP_000404940.1.18955 WP_000404940.1.18985 WP_000404940.1.18999 WP_000404940.1.19000 WP_000404940.1.19003 WP_000404940.1.19010 WP_000404940.1.19045 WP_000404940.1.19049 WP_000404940.1.19103 WP_000404940.1.19104 WP_000404940.1.19124 WP_000404940.1.19127 WP_000404940.1.19157 WP_000404940.1.19162 WP_000404940.1.19172 WP_000404940.1.19184 WP_000404940.1.19190 WP_000404940.1.19201 WP_000404940.1.19216 WP_000404940.1.19236 WP_000404940.1.19239 WP_000404940.1.19275 WP_000404940.1.19359 WP_000404940.1.19368 WP_000404940.1.19383 WP_000404940.1.19385 WP_000404940.1.19392 WP_000404940.1.19420 WP_000404940.1.19466 WP_000404940.1.19467 WP_000404940.1.19470 WP_000404940.1.19489 WP_000404940.1.19490 WP_000404940.1.19493 WP_000404940.1.19510 WP_000404940.1.19513 WP_000404940.1.19527 WP_000404940.1.19530 WP_000404940.1.19532 WP_000404940.1.19558 WP_000404940.1.19631 WP_000404940.1.19633 WP_000404940.1.19677 WP_000404940.1.1972 WP_000404940.1.19721 WP_000404940.1.19729 WP_000404940.1.19730 WP_000404940.1.19754 WP_000404940.1.19827 WP_000404940.1.1983 WP_000404940.1.19832 WP_000404940.1.1985 WP_000404940.1.19856 WP_000404940.1.19879 WP_000404940.1.19880 WP_000404940.1.19925 WP_000404940.1.19942 WP_000404940.1.1996 WP_000404940.1.19995 WP_000404940.1.20008 WP_000404940.1.20011 WP_000404940.1.20015 WP_000404940.1.20045 WP_000404940.1.20079 WP_000404940.1.20110 WP_000404940.1.20124 WP_000404940.1.20128 WP_000404940.1.20139 WP_000404940.1.20149 WP_000404940.1.2017 WP_000404940.1.20185 WP_000404940.1.2019 WP_000404940.1.20207 WP_000404940.1.20209 WP_000404940.1.20213 WP_000404940.1.20227 WP_000404940.1.20241 WP_000404940.1.20250 WP_000404940.1.20274 WP_000404940.1.20298 WP_000404940.1.2030 WP_000404940.1.20301 WP_000404940.1.20312 WP_000404940.1.20328 WP_000404940.1.20382 WP_000404940.1.20385 WP_000404940.1.20396 WP_000404940.1.20407 WP_000404940.1.20408 WP_000404940.1.20413 WP_000404940.1.20421 WP_000404940.1.20422 WP_000404940.1.20451 WP_000404940.1.20470 WP_000404940.1.20486 WP_000404940.1.20491 WP_000404940.1.20509 WP_000404940.1.20516 WP_000404940.1.20568 WP_000404940.1.2060 WP_000404940.1.20603 WP_000404940.1.20634 WP_000404940.1.20637 WP_000404940.1.20657 WP_000404940.1.20671 WP_000404940.1.20681 WP_000404940.1.20701 WP_000404940.1.20702 WP_000404940.1.20711 WP_000404940.1.20766 WP_000404940.1.2078 WP_000404940.1.20781 WP_000404940.1.20805 WP_000404940.1.20856 WP_000404940.1.20858 WP_000404940.1.20909 WP_000404940.1.20915 WP_000404940.1.20934 WP_000404940.1.20936 WP_000404940.1.20942 WP_000404940.1.20952 WP_000404940.1.20966 WP_000404940.1.20976 WP_000404940.1.20984 WP_000404940.1.20988 WP_000404940.1.21027 WP_000404940.1.21028 WP_000404940.1.21095 WP_000404940.1.21097 WP_000404940.1.21174 WP_000404940.1.21175 WP_000404940.1.21176 WP_000404940.1.21192 WP_000404940.1.21211 WP_000404940.1.21214 WP_000404940.1.21233 WP_000404940.1.21244 WP_000404940.1.21256 WP_000404940.1.21271 WP_000404940.1.21278 WP_000404940.1.21297 WP_000404940.1.21329 WP_000404940.1.21331 WP_000404940.1.21355 WP_000404940.1.21370 WP_000404940.1.21377 WP_000404940.1.21394 WP_000404940.1.21421 WP_000404940.1.21422 WP_000404940.1.21426 WP_000404940.1.21435 WP_000404940.1.21436 WP_000404940.1.21445 WP_000404940.1.21452 WP_000404940.1.2147 WP_000404940.1.2148 WP_000404940.1.21490 WP_000404940.1.21495 WP_000404940.1.21503 WP_000404940.1.2152 WP_000404940.1.21551 WP_000404940.1.21599 WP_000404940.1.21604 WP_000404940.1.21605 WP_000404940.1.21620 WP_000404940.1.21642 WP_000404940.1.2167 WP_000404940.1.21675 WP_000404940.1.21682 WP_000404940.1.21685 WP_000404940.1.21691 WP_000404940.1.21697 WP_000404940.1.21699 WP_000404940.1.21701 WP_000404940.1.2173 WP_000404940.1.21735 WP_000404940.1.21753 WP_000404940.1.21781 WP_000404940.1.21788 WP_000404940.1.21790 WP_000404940.1.2180 WP_000404940.1.21807 WP_000404940.1.21822 WP_000404940.1.21824 WP_000404940.1.21838 WP_000404940.1.21848 WP_000404940.1.21904 WP_000404940.1.21957 WP_000404940.1.21979 WP_000404940.1.21997 WP_000404940.1.21998 WP_000404940.1.22 WP_000404940.1.22014 WP_000404940.1.22016 WP_000404940.1.2202 WP_000404940.1.2203 WP_000404940.1.22043 WP_000404940.1.22048 WP_000404940.1.22057 WP_000404940.1.22058 WP_000404940.1.22083 WP_000404940.1.22119 WP_000404940.1.22122 WP_000404940.1.22124 WP_000404940.1.22131 WP_000404940.1.22135 WP_000404940.1.22146 WP_000404940.1.22179 WP_000404940.1.22186 WP_000404940.1.22196 WP_000404940.1.22201 WP_000404940.1.22262 WP_000404940.1.22263 WP_000404940.1.22271 WP_000404940.1.22297 WP_000404940.1.223 WP_000404940.1.22338 WP_000404940.1.22341 WP_000404940.1.22343 WP_000404940.1.22382 WP_000404940.1.22436 WP_000404940.1.22457 WP_000404940.1.22459 WP_000404940.1.22480 WP_000404940.1.22497 WP_000404940.1.22503 WP_000404940.1.22506 WP_000404940.1.22546 WP_000404940.1.2255 WP_000404940.1.22550 WP_000404940.1.22556 WP_000404940.1.22561 WP_000404940.1.2257 WP_000404940.1.22591 WP_000404940.1.22596 WP_000404940.1.2260 WP_000404940.1.22612 WP_000404940.1.22616 WP_000404940.1.2263 WP_000404940.1.22636 WP_000404940.1.22637 WP_000404940.1.22638 WP_000404940.1.22640 WP_000404940.1.22655 WP_000404940.1.22677 WP_000404940.1.22700 WP_000404940.1.22717 WP_000404940.1.22723 WP_000404940.1.22745 WP_000404940.1.22751 WP_000404940.1.22753 WP_000404940.1.22763 WP_000404940.1.22772 WP_000404940.1.22784 WP_000404940.1.22820 WP_000404940.1.22839 WP_000404940.1.22884 WP_000404940.1.22897 WP_000404940.1.22904 WP_000404940.1.2291 WP_000404940.1.22914 WP_000404940.1.22938 WP_000404940.1.22941 WP_000404940.1.2296 WP_000404940.1.22976 WP_000404940.1.23016 WP_000404940.1.23018 WP_000404940.1.23025 WP_000404940.1.23028 WP_000404940.1.23031 WP_000404940.1.23039 WP_000404940.1.23043 WP_000404940.1.23066 WP_000404940.1.23077 WP_000404940.1.23083 WP_000404940.1.23097 WP_000404940.1.23107 WP_000404940.1.23111 WP_000404940.1.23138 WP_000404940.1.23177 WP_000404940.1.23178 WP_000404940.1.23180 WP_000404940.1.2319 WP_000404940.1.23190 WP_000404940.1.23320 WP_000404940.1.23326 WP_000404940.1.23332 WP_000404940.1.23334 WP_000404940.1.23354 WP_000404940.1.23397 WP_000404940.1.23415 WP_000404940.1.23432 WP_000404940.1.23477 WP_000404940.1.23481 WP_000404940.1.23536 WP_000404940.1.23602 WP_000404940.1.23606 WP_000404940.1.2361 WP_000404940.1.23620 WP_000404940.1.23633 WP_000404940.1.23635 WP_000404940.1.23649 WP_000404940.1.23656 WP_000404940.1.23659 WP_000404940.1.23668 WP_000404940.1.23696 WP_000404940.1.23703 WP_000404940.1.23713 WP_000404940.1.23722 WP_000404940.1.23742 WP_000404940.1.23791 WP_000404940.1.23798 WP_000404940.1.23847 WP_000404940.1.23853 WP_000404940.1.23889 WP_000404940.1.239 WP_000404940.1.23903 WP_000404940.1.23929 WP_000404940.1.23930 WP_000404940.1.23937 WP_000404940.1.23964 WP_000404940.1.23966 WP_000404940.1.23968 WP_000404940.1.23978 WP_000404940.1.23988 WP_000404940.1.24010 WP_000404940.1.24040 WP_000404940.1.24043 WP_000404940.1.24060 WP_000404940.1.24067 WP_000404940.1.24085 WP_000404940.1.24094 WP_000404940.1.24098 WP_000404940.1.24102 WP_000404940.1.24116 WP_000404940.1.24203 WP_000404940.1.24222 WP_000404940.1.24247 WP_000404940.1.24262 WP_000404940.1.2429 WP_000404940.1.243 WP_000404940.1.2431 WP_000404940.1.24312 WP_000404940.1.24318 WP_000404940.1.24324 WP_000404940.1.24356 WP_000404940.1.24395 WP_000404940.1.24401 WP_000404940.1.2444 WP_000404940.1.24440 WP_000404940.1.24466 WP_000404940.1.24471 WP_000404940.1.24481 WP_000404940.1.24497 WP_000404940.1.24501 WP_000404940.1.24540 WP_000404940.1.24542 WP_000404940.1.24562 WP_000404940.1.24571 WP_000404940.1.24573 WP_000404940.1.24574 WP_000404940.1.2459 WP_000404940.1.24598 WP_000404940.1.2461 WP_000404940.1.24620 WP_000404940.1.24627 WP_000404940.1.24630 WP_000404940.1.2465 WP_000404940.1.24658 WP_000404940.1.24678 WP_000404940.1.24724 WP_000404940.1.24742 WP_000404940.1.24772 WP_000404940.1.24788 WP_000404940.1.24825 WP_000404940.1.24835 WP_000404940.1.24844 WP_000404940.1.24852 WP_000404940.1.24871 WP_000404940.1.24874 WP_000404940.1.249 WP_000404940.1.24928 WP_000404940.1.24947 WP_000404940.1.24970 WP_000404940.1.24989 WP_000404940.1.25005 WP_000404940.1.2503 WP_000404940.1.25084 WP_000404940.1.25106 WP_000404940.1.25121 WP_000404940.1.25124 WP_000404940.1.25132 WP_000404940.1.25139 WP_000404940.1.25153 WP_000404940.1.252 WP_000404940.1.25202 WP_000404940.1.25226 WP_000404940.1.25264 WP_000404940.1.25293 WP_000404940.1.2533 WP_000404940.1.25337 WP_000404940.1.25340 WP_000404940.1.25366 WP_000404940.1.25383 WP_000404940.1.25424 WP_000404940.1.25439 WP_000404940.1.25461 WP_000404940.1.25483 WP_000404940.1.25494 WP_000404940.1.25502 WP_000404940.1.25507 WP_000404940.1.2553 WP_000404940.1.25538 WP_000404940.1.25543 WP_000404940.1.25545 WP_000404940.1.25553 WP_000404940.1.2556 WP_000404940.1.25571 WP_000404940.1.25581 WP_000404940.1.25589 WP_000404940.1.25624 WP_000404940.1.25660 WP_000404940.1.25662 WP_000404940.1.25684 WP_000404940.1.25685 WP_000404940.1.25686 WP_000404940.1.25696 WP_000404940.1.25707 WP_000404940.1.25714 WP_000404940.1.2573 WP_000404940.1.25742 WP_000404940.1.25749 WP_000404940.1.25754 WP_000404940.1.25767 WP_000404940.1.25768 WP_000404940.1.25771 WP_000404940.1.25783 WP_000404940.1.25785 WP_000404940.1.25791 WP_000404940.1.25792 WP_000404940.1.25818 WP_000404940.1.25845 WP_000404940.1.2586 WP_000404940.1.25883 WP_000404940.1.25897 WP_000404940.1.25934 WP_000404940.1.25952 WP_000404940.1.25958 WP_000404940.1.25966 WP_000404940.1.25982 WP_000404940.1.25986 WP_000404940.1.25994 WP_000404940.1.26041 WP_000404940.1.26059 WP_000404940.1.26078 WP_000404940.1.26085 WP_000404940.1.2610 WP_000404940.1.26111 WP_000404940.1.26141 WP_000404940.1.26165 WP_000404940.1.26208 WP_000404940.1.26218 WP_000404940.1.26220 WP_000404940.1.26257 WP_000404940.1.26279 WP_000404940.1.26280 WP_000404940.1.2629 WP_000404940.1.26317 WP_000404940.1.26344 WP_000404940.1.26369 WP_000404940.1.26371 WP_000404940.1.26389 WP_000404940.1.26392 WP_000404940.1.26413 WP_000404940.1.26447 WP_000404940.1.26470 WP_000404940.1.26484 WP_000404940.1.26490 WP_000404940.1.26496 WP_000404940.1.26497 WP_000404940.1.26518 WP_000404940.1.26544 WP_000404940.1.26566 WP_000404940.1.26625 WP_000404940.1.26653 WP_000404940.1.26698 WP_000404940.1.26725 WP_000404940.1.26743 WP_000404940.1.26755 WP_000404940.1.26793 WP_000404940.1.26799 WP_000404940.1.26807 WP_000404940.1.26818 WP_000404940.1.26823 WP_000404940.1.26855 WP_000404940.1.26875 WP_000404940.1.26877 WP_000404940.1.26879 WP_000404940.1.26901 WP_000404940.1.26909 WP_000404940.1.26910 WP_000404940.1.26918 WP_000404940.1.26925 WP_000404940.1.26926 WP_000404940.1.26953 WP_000404940.1.26968 WP_000404940.1.26983 WP_000404940.1.26985 WP_000404940.1.26988 WP_000404940.1.26990 WP_000404940.1.26994 WP_000404940.1.27001 WP_000404940.1.27007 WP_000404940.1.27022 WP_000404940.1.27046 WP_000404940.1.27047 WP_000404940.1.27048 WP_000404940.1.27071 WP_000404940.1.27076 WP_000404940.1.27078 WP_000404940.1.27082 WP_000404940.1.27119 WP_000404940.1.27131 WP_000404940.1.27135 WP_000404940.1.27149 WP_000404940.1.27151 WP_000404940.1.27174 WP_000404940.1.2721 WP_000404940.1.27210 WP_000404940.1.27219 WP_000404940.1.2724 WP_000404940.1.27249 WP_000404940.1.27252 WP_000404940.1.27267 WP_000404940.1.27289 WP_000404940.1.2729 WP_000404940.1.27312 WP_000404940.1.27315 WP_000404940.1.27324 WP_000404940.1.27347 WP_000404940.1.27382 WP_000404940.1.27392 WP_000404940.1.27394 WP_000404940.1.27405 WP_000404940.1.27418 WP_000404940.1.27428 WP_000404940.1.27432 WP_000404940.1.27440 WP_000404940.1.27478 WP_000404940.1.27479 WP_000404940.1.27484 WP_000404940.1.2750 WP_000404940.1.2752 WP_000404940.1.27573 WP_000404940.1.27581 WP_000404940.1.27589 WP_000404940.1.276 WP_000404940.1.27601 WP_000404940.1.27610 WP_000404940.1.27636 WP_000404940.1.27684 WP_000404940.1.27686 WP_000404940.1.27714 WP_000404940.1.27721 WP_000404940.1.27746 WP_000404940.1.27759 WP_000404940.1.27768 WP_000404940.1.27791 WP_000404940.1.27829 WP_000404940.1.27853 WP_000404940.1.2786 WP_000404940.1.27862 WP_000404940.1.27865 WP_000404940.1.27866 WP_000404940.1.27868 WP_000404940.1.27886 WP_000404940.1.27887 WP_000404940.1.27904 WP_000404940.1.27907 WP_000404940.1.2791 WP_000404940.1.27912 WP_000404940.1.27964 WP_000404940.1.27988 WP_000404940.1.28014 WP_000404940.1.28028 WP_000404940.1.28058 WP_000404940.1.28089 WP_000404940.1.28104 WP_000404940.1.28146 WP_000404940.1.28151 WP_000404940.1.28162 WP_000404940.1.28180 WP_000404940.1.28183 WP_000404940.1.28231 WP_000404940.1.28248 WP_000404940.1.28259 WP_000404940.1.28264 WP_000404940.1.2827 WP_000404940.1.28296 WP_000404940.1.2830 WP_000404940.1.28307 WP_000404940.1.28326 WP_000404940.1.28350 WP_000404940.1.28351 WP_000404940.1.28353 WP_000404940.1.28379 WP_000404940.1.28408 WP_000404940.1.28450 WP_000404940.1.28451 WP_000404940.1.28458 WP_000404940.1.28460 WP_000404940.1.28519 WP_000404940.1.28524 WP_000404940.1.28537 WP_000404940.1.28542 WP_000404940.1.28548 WP_000404940.1.28549 WP_000404940.1.2857 WP_000404940.1.28572 WP_000404940.1.28574 WP_000404940.1.28589 WP_000404940.1.28604 WP_000404940.1.28608 WP_000404940.1.2861 WP_000404940.1.28643 WP_000404940.1.28659 WP_000404940.1.28667 WP_000404940.1.2868 WP_000404940.1.28680 WP_000404940.1.28708 WP_000404940.1.28709 WP_000404940.1.28714 WP_000404940.1.28740 WP_000404940.1.28746 WP_000404940.1.28761 WP_000404940.1.28767 WP_000404940.1.28771 WP_000404940.1.28772 WP_000404940.1.28794 WP_000404940.1.28812 WP_000404940.1.28816 WP_000404940.1.28834 WP_000404940.1.28836 WP_000404940.1.28846 WP_000404940.1.28867 WP_000404940.1.28868 WP_000404940.1.28869 WP_000404940.1.28892 WP_000404940.1.28931 WP_000404940.1.28945 WP_000404940.1.28956 WP_000404940.1.28986 WP_000404940.1.28997 WP_000404940.1.2900 WP_000404940.1.29009 WP_000404940.1.29018 WP_000404940.1.29039 WP_000404940.1.29041 WP_000404940.1.29046 WP_000404940.1.29069 WP_000404940.1.29076 WP_000404940.1.2909 WP_000404940.1.29098 WP_000404940.1.29104 WP_000404940.1.29105 WP_000404940.1.2911 WP_000404940.1.29151 WP_000404940.1.29175 WP_000404940.1.29181 WP_000404940.1.29192 WP_000404940.1.29204 WP_000404940.1.29205 WP_000404940.1.29210 WP_000404940.1.2922 WP_000404940.1.29222 WP_000404940.1.29232 WP_000404940.1.29249 WP_000404940.1.29253 WP_000404940.1.29269 WP_000404940.1.29280 WP_000404940.1.29286 WP_000404940.1.29289 WP_000404940.1.29300 WP_000404940.1.29307 WP_000404940.1.29317 WP_000404940.1.29321 WP_000404940.1.29323 WP_000404940.1.29337 WP_000404940.1.29338 WP_000404940.1.29343 WP_000404940.1.29351 WP_000404940.1.29357 WP_000404940.1.2940 WP_000404940.1.29406 WP_000404940.1.29442 WP_000404940.1.29469 WP_000404940.1.29473 WP_000404940.1.2951 WP_000404940.1.29536 WP_000404940.1.29549 WP_000404940.1.29572 WP_000404940.1.29626 WP_000404940.1.29628 WP_000404940.1.29642 WP_000404940.1.29655 WP_000404940.1.29687 WP_000404940.1.29694 WP_000404940.1.2970 WP_000404940.1.29702 WP_000404940.1.29712 WP_000404940.1.29730 WP_000404940.1.29734 WP_000404940.1.29751 WP_000404940.1.29783 WP_000404940.1.29810 WP_000404940.1.29828 WP_000404940.1.29852 WP_000404940.1.29868 WP_000404940.1.29881 WP_000404940.1.29894 WP_000404940.1.29921 WP_000404940.1.29929 WP_000404940.1.29944 WP_000404940.1.29951 WP_000404940.1.29980 WP_000404940.1.30011 WP_000404940.1.30038 WP_000404940.1.30055 WP_000404940.1.30065 WP_000404940.1.30066 WP_000404940.1.3008 WP_000404940.1.30102 WP_000404940.1.3011 WP_000404940.1.30119 WP_000404940.1.30133 WP_000404940.1.30134 WP_000404940.1.30135 WP_000404940.1.30137 WP_000404940.1.30151 WP_000404940.1.30167 WP_000404940.1.30219 WP_000404940.1.30229 WP_000404940.1.30233 WP_000404940.1.30234 WP_000404940.1.30243 WP_000404940.1.30245 WP_000404940.1.30250 WP_000404940.1.30255 WP_000404940.1.30287 WP_000404940.1.30290 WP_000404940.1.30295 WP_000404940.1.30297 WP_000404940.1.30301 WP_000404940.1.30305 WP_000404940.1.30326 WP_000404940.1.30335 WP_000404940.1.30342 WP_000404940.1.30370 WP_000404940.1.3040 WP_000404940.1.30406 WP_000404940.1.30435 WP_000404940.1.30443 WP_000404940.1.30446 WP_000404940.1.30480 WP_000404940.1.30481 WP_000404940.1.30487 WP_000404940.1.30514 WP_000404940.1.30515 WP_000404940.1.30538 WP_000404940.1.30543 WP_000404940.1.30545 WP_000404940.1.30549 WP_000404940.1.30553 WP_000404940.1.30564 WP_000404940.1.3058 WP_000404940.1.30588 WP_000404940.1.30591 WP_000404940.1.30607 WP_000404940.1.3061 WP_000404940.1.30612 WP_000404940.1.30647 WP_000404940.1.30676 WP_000404940.1.30705 WP_000404940.1.30711 WP_000404940.1.30712 WP_000404940.1.30724 WP_000404940.1.30755 WP_000404940.1.30757 WP_000404940.1.3084 WP_000404940.1.30865 WP_000404940.1.30869 WP_000404940.1.30891 WP_000404940.1.30923 WP_000404940.1.30933 WP_000404940.1.30942 WP_000404940.1.30948 WP_000404940.1.3096 WP_000404940.1.30964 WP_000404940.1.30982 WP_000404940.1.30984 WP_000404940.1.31004 WP_000404940.1.31006 WP_000404940.1.3105 WP_000404940.1.31057 WP_000404940.1.31059 WP_000404940.1.3106 WP_000404940.1.31082 WP_000404940.1.31099 WP_000404940.1.31134 WP_000404940.1.31191 WP_000404940.1.31216 WP_000404940.1.31218 WP_000404940.1.31256 WP_000404940.1.31275 WP_000404940.1.31276 WP_000404940.1.31283 WP_000404940.1.31322 WP_000404940.1.3133 WP_000404940.1.31333 WP_000404940.1.31367 WP_000404940.1.31420 WP_000404940.1.31427 WP_000404940.1.31439 WP_000404940.1.31443 WP_000404940.1.31466 WP_000404940.1.31473 WP_000404940.1.31488 WP_000404940.1.31493 WP_000404940.1.31499 WP_000404940.1.3152 WP_000404940.1.31522 WP_000404940.1.31550 WP_000404940.1.31553 WP_000404940.1.31574 WP_000404940.1.31586 WP_000404940.1.31603 WP_000404940.1.3161 WP_000404940.1.31619 WP_000404940.1.31620 WP_000404940.1.31650 WP_000404940.1.31651 WP_000404940.1.31652 WP_000404940.1.31688 WP_000404940.1.31695 WP_000404940.1.31705 WP_000404940.1.31755 WP_000404940.1.31757 WP_000404940.1.31759 WP_000404940.1.31767 WP_000404940.1.3178 WP_000404940.1.31822 WP_000404940.1.31876 WP_000404940.1.31887 WP_000404940.1.31889 WP_000404940.1.3191 WP_000404940.1.31912 WP_000404940.1.31915 WP_000404940.1.31935 WP_000404940.1.31945 WP_000404940.1.31974 WP_000404940.1.31975 WP_000404940.1.31979 WP_000404940.1.31989 WP_000404940.1.31996 WP_000404940.1.320 WP_000404940.1.32027 WP_000404940.1.32032 WP_000404940.1.32035 WP_000404940.1.32058 WP_000404940.1.32068 WP_000404940.1.32080 WP_000404940.1.32083 WP_000404940.1.32084 WP_000404940.1.32097 WP_000404940.1.32108 WP_000404940.1.3211 WP_000404940.1.32110 WP_000404940.1.32117 WP_000404940.1.32128 WP_000404940.1.32139 WP_000404940.1.32171 WP_000404940.1.32186 WP_000404940.1.32187 WP_000404940.1.32246 WP_000404940.1.32261 WP_000404940.1.32280 WP_000404940.1.32282 WP_000404940.1.32288 WP_000404940.1.32290 WP_000404940.1.32296 WP_000404940.1.32303 WP_000404940.1.32313 WP_000404940.1.32320 WP_000404940.1.32344 WP_000404940.1.32351 WP_000404940.1.32362 WP_000404940.1.32389 WP_000404940.1.32397 WP_000404940.1.3241 WP_000404940.1.32413 WP_000404940.1.32439 WP_000404940.1.32444 WP_000404940.1.32469 WP_000404940.1.32485 WP_000404940.1.32507 WP_000404940.1.32540 WP_000404940.1.32550 WP_000404940.1.32604 WP_000404940.1.32606 WP_000404940.1.32642 WP_000404940.1.32644 WP_000404940.1.32667 WP_000404940.1.32688 WP_000404940.1.32689 WP_000404940.1.32696 WP_000404940.1.32701 WP_000404940.1.32717 WP_000404940.1.32734 WP_000404940.1.32735 WP_000404940.1.32768 WP_000404940.1.32771 WP_000404940.1.32782 WP_000404940.1.32792 WP_000404940.1.32794 WP_000404940.1.32816 WP_000404940.1.3287 WP_000404940.1.32876 WP_000404940.1.32906 WP_000404940.1.32923 WP_000404940.1.32924 WP_000404940.1.32949 WP_000404940.1.32968 WP_000404940.1.32986 WP_000404940.1.32994 WP_000404940.1.33001 WP_000404940.1.33005 WP_000404940.1.33013 WP_000404940.1.33020 WP_000404940.1.33021 WP_000404940.1.33034 WP_000404940.1.33070 WP_000404940.1.33071 WP_000404940.1.33072 WP_000404940.1.33073 WP_000404940.1.33091 WP_000404940.1.33113 WP_000404940.1.33128 WP_000404940.1.33135 WP_000404940.1.33166 WP_000404940.1.33180 WP_000404940.1.33182 WP_000404940.1.33188 WP_000404940.1.3319 WP_000404940.1.33233 WP_000404940.1.33259 WP_000404940.1.33271 WP_000404940.1.33286 WP_000404940.1.33291 WP_000404940.1.33334 WP_000404940.1.33354 WP_000404940.1.33359 WP_000404940.1.33361 WP_000404940.1.33378 WP_000404940.1.33391 WP_000404940.1.33415 WP_000404940.1.33436 WP_000404940.1.33437 WP_000404940.1.33451 WP_000404940.1.33454 WP_000404940.1.33458 WP_000404940.1.33482 WP_000404940.1.33511 WP_000404940.1.33546 WP_000404940.1.3359 WP_000404940.1.33598 WP_000404940.1.33634 WP_000404940.1.33647 WP_000404940.1.33666 WP_000404940.1.33674 WP_000404940.1.33709 WP_000404940.1.33710 WP_000404940.1.33719 WP_000404940.1.33727 WP_000404940.1.33749 WP_000404940.1.33758 WP_000404940.1.33781 WP_000404940.1.33791 WP_000404940.1.33802 WP_000404940.1.33807 WP_000404940.1.33808 WP_000404940.1.33815 WP_000404940.1.3384 WP_000404940.1.33859 WP_000404940.1.33862 WP_000404940.1.33874 WP_000404940.1.33878 WP_000404940.1.33881 WP_000404940.1.33882 WP_000404940.1.33891 WP_000404940.1.33897 WP_000404940.1.33908 WP_000404940.1.33923 WP_000404940.1.33953 WP_000404940.1.33956 WP_000404940.1.34007 WP_000404940.1.34015 WP_000404940.1.34028 WP_000404940.1.34041 WP_000404940.1.34047 WP_000404940.1.34054 WP_000404940.1.34083 WP_000404940.1.34097 WP_000404940.1.34162 WP_000404940.1.34176 WP_000404940.1.34177 WP_000404940.1.34196 WP_000404940.1.34212 WP_000404940.1.34262 WP_000404940.1.3427 WP_000404940.1.34272 WP_000404940.1.34291 WP_000404940.1.34297 WP_000404940.1.34301 WP_000404940.1.34309 WP_000404940.1.34327 WP_000404940.1.3433 WP_000404940.1.34335 WP_000404940.1.34449 WP_000404940.1.34466 WP_000404940.1.34474 WP_000404940.1.34485 WP_000404940.1.34506 WP_000404940.1.34508 WP_000404940.1.34522 WP_000404940.1.34548 WP_000404940.1.34559 WP_000404940.1.34598 WP_000404940.1.34601 WP_000404940.1.34603 WP_000404940.1.34616 WP_000404940.1.3464 WP_000404940.1.34651 WP_000404940.1.34662 WP_000404940.1.34690 WP_000404940.1.34699 WP_000404940.1.34713 WP_000404940.1.34719 WP_000404940.1.34739 WP_000404940.1.34742 WP_000404940.1.34744 WP_000404940.1.34746 WP_000404940.1.34754 WP_000404940.1.34772 WP_000404940.1.34776 WP_000404940.1.34785 WP_000404940.1.34792 WP_000404940.1.34796 WP_000404940.1.34839 WP_000404940.1.34848 WP_000404940.1.3486 WP_000404940.1.3487 WP_000404940.1.34872 WP_000404940.1.34879 WP_000404940.1.34886 WP_000404940.1.34899 WP_000404940.1.3496 WP_000404940.1.34973 WP_000404940.1.3502 WP_000404940.1.35020 WP_000404940.1.35027 WP_000404940.1.35034 WP_000404940.1.35042 WP_000404940.1.3505 WP_000404940.1.35064 WP_000404940.1.35076 WP_000404940.1.351 WP_000404940.1.35103 WP_000404940.1.35117 WP_000404940.1.35124 WP_000404940.1.35133 WP_000404940.1.35151 WP_000404940.1.35157 WP_000404940.1.35167 WP_000404940.1.35178 WP_000404940.1.35217 WP_000404940.1.35218 WP_000404940.1.35232 WP_000404940.1.35239 WP_000404940.1.35247 WP_000404940.1.35254 WP_000404940.1.35305 WP_000404940.1.35358 WP_000404940.1.3537 WP_000404940.1.35380 WP_000404940.1.35383 WP_000404940.1.35392 WP_000404940.1.35406 WP_000404940.1.35411 WP_000404940.1.35432 WP_000404940.1.35447 WP_000404940.1.35458 WP_000404940.1.35459 WP_000404940.1.35482 WP_000404940.1.35521 WP_000404940.1.35523 WP_000404940.1.35528 WP_000404940.1.35597 WP_000404940.1.356 WP_000404940.1.35614 WP_000404940.1.35616 WP_000404940.1.35625 WP_000404940.1.35634 WP_000404940.1.35655 WP_000404940.1.35665 WP_000404940.1.35678 WP_000404940.1.35685 WP_000404940.1.35702 WP_000404940.1.35708 WP_000404940.1.3571 WP_000404940.1.35727 WP_000404940.1.35735 WP_000404940.1.35763 WP_000404940.1.35773 WP_000404940.1.35776 WP_000404940.1.35798 WP_000404940.1.35827 WP_000404940.1.35836 WP_000404940.1.35851 WP_000404940.1.35875 WP_000404940.1.35882 WP_000404940.1.3589 WP_000404940.1.35905 WP_000404940.1.35920 WP_000404940.1.35924 WP_000404940.1.35925 WP_000404940.1.35932 WP_000404940.1.35943 WP_000404940.1.3596 WP_000404940.1.35960 WP_000404940.1.35967 WP_000404940.1.3597 WP_000404940.1.35972 WP_000404940.1.35986 WP_000404940.1.36002 WP_000404940.1.36054 WP_000404940.1.36060 WP_000404940.1.36077 WP_000404940.1.3608 WP_000404940.1.3609 WP_000404940.1.36090 WP_000404940.1.36131 WP_000404940.1.36139 WP_000404940.1.36162 WP_000404940.1.36167 WP_000404940.1.3618 WP_000404940.1.3619 WP_000404940.1.36206 WP_000404940.1.3621 WP_000404940.1.36214 WP_000404940.1.36242 WP_000404940.1.36247 WP_000404940.1.3625 WP_000404940.1.36272 WP_000404940.1.36300 WP_000404940.1.36317 WP_000404940.1.36330 WP_000404940.1.36377 WP_000404940.1.3638 WP_000404940.1.36404 WP_000404940.1.36411 WP_000404940.1.36429 WP_000404940.1.36448 WP_000404940.1.36450 WP_000404940.1.3646 WP_000404940.1.36463 WP_000404940.1.36471 WP_000404940.1.36476 WP_000404940.1.36492 WP_000404940.1.36493 WP_000404940.1.36510 WP_000404940.1.36538 WP_000404940.1.36546 WP_000404940.1.36552 WP_000404940.1.36554 WP_000404940.1.36568 WP_000404940.1.36591 WP_000404940.1.36641 WP_000404940.1.36653 WP_000404940.1.36688 WP_000404940.1.367 WP_000404940.1.36715 WP_000404940.1.36731 WP_000404940.1.3674 WP_000404940.1.36741 WP_000404940.1.36750 WP_000404940.1.36762 WP_000404940.1.36772 WP_000404940.1.36780 WP_000404940.1.36795 WP_000404940.1.36803 WP_000404940.1.36867 WP_000404940.1.36923 WP_000404940.1.36943 WP_000404940.1.36961 WP_000404940.1.36965 WP_000404940.1.36982 WP_000404940.1.36992 WP_000404940.1.36993 WP_000404940.1.37022 WP_000404940.1.37024 WP_000404940.1.37033 WP_000404940.1.37034 WP_000404940.1.3705 WP_000404940.1.37068 WP_000404940.1.37107 WP_000404940.1.37115 WP_000404940.1.37118 WP_000404940.1.37136 WP_000404940.1.37142 WP_000404940.1.37164 WP_000404940.1.37166 WP_000404940.1.37170 WP_000404940.1.37194 WP_000404940.1.37205 WP_000404940.1.37209 WP_000404940.1.37227 WP_000404940.1.37230 WP_000404940.1.37243 WP_000404940.1.37246 WP_000404940.1.37250 WP_000404940.1.37268 WP_000404940.1.37280 WP_000404940.1.37282 WP_000404940.1.37289 WP_000404940.1.37300 WP_000404940.1.37301 WP_000404940.1.37310 WP_000404940.1.37324 WP_000404940.1.37340 WP_000404940.1.37346 WP_000404940.1.37357 WP_000404940.1.37390 WP_000404940.1.37443 WP_000404940.1.37447 WP_000404940.1.37450 WP_000404940.1.37457 WP_000404940.1.37458 WP_000404940.1.37479 WP_000404940.1.37488 WP_000404940.1.37508 WP_000404940.1.37522 WP_000404940.1.37526 WP_000404940.1.37540 WP_000404940.1.37541 WP_000404940.1.37575 WP_000404940.1.37599 WP_000404940.1.37629 WP_000404940.1.3763 WP_000404940.1.37640 WP_000404940.1.37658 WP_000404940.1.37684 WP_000404940.1.37696 WP_000404940.1.37713 WP_000404940.1.37728 WP_000404940.1.37746 WP_000404940.1.37790 WP_000404940.1.3780 WP_000404940.1.37827 WP_000404940.1.37840 WP_000404940.1.37858 WP_000404940.1.37876 WP_000404940.1.37883 WP_000404940.1.37921 WP_000404940.1.37944 WP_000404940.1.37989 WP_000404940.1.38014 WP_000404940.1.38024 WP_000404940.1.38029 WP_000404940.1.38056 WP_000404940.1.38093 WP_000404940.1.38109 WP_000404940.1.38161 WP_000404940.1.38184 WP_000404940.1.38216 WP_000404940.1.38220 WP_000404940.1.38238 WP_000404940.1.38268 WP_000404940.1.38275 WP_000404940.1.38288 WP_000404940.1.38294 WP_000404940.1.38324 WP_000404940.1.38355 WP_000404940.1.38374 WP_000404940.1.38429 WP_000404940.1.3844 WP_000404940.1.38465 WP_000404940.1.38497 WP_000404940.1.38503 WP_000404940.1.38506 WP_000404940.1.38507 WP_000404940.1.38519 WP_000404940.1.38521 WP_000404940.1.38527 WP_000404940.1.38560 WP_000404940.1.38573 WP_000404940.1.38588 WP_000404940.1.38602 WP_000404940.1.38605 WP_000404940.1.38624 WP_000404940.1.3864 WP_000404940.1.38640 WP_000404940.1.38643 WP_000404940.1.38665 WP_000404940.1.38675 WP_000404940.1.38676 WP_000404940.1.38695 WP_000404940.1.38708 WP_000404940.1.38718 WP_000404940.1.38738 WP_000404940.1.3876 WP_000404940.1.38765 WP_000404940.1.3877 WP_000404940.1.38770 WP_000404940.1.38778 WP_000404940.1.38783 WP_000404940.1.3882 WP_000404940.1.38825 WP_000404940.1.3883 WP_000404940.1.38840 WP_000404940.1.3885 WP_000404940.1.38851 WP_000404940.1.38855 WP_000404940.1.38860 WP_000404940.1.38868 WP_000404940.1.38887 WP_000404940.1.38892 WP_000404940.1.38906 WP_000404940.1.38918 WP_000404940.1.38930 WP_000404940.1.38934 WP_000404940.1.38949 WP_000404940.1.38955 WP_000404940.1.38957 WP_000404940.1.38969 WP_000404940.1.3899 WP_000404940.1.39006 WP_000404940.1.39033 WP_000404940.1.39051 WP_000404940.1.39071 WP_000404940.1.39074 WP_000404940.1.39079 WP_000404940.1.39083 WP_000404940.1.39087 WP_000404940.1.39093 WP_000404940.1.39097 WP_000404940.1.39098 WP_000404940.1.39121 WP_000404940.1.39124 WP_000404940.1.39125 WP_000404940.1.39133 WP_000404940.1.3916 WP_000404940.1.3917 WP_000404940.1.39175 WP_000404940.1.39198 WP_000404940.1.392 WP_000404940.1.39227 WP_000404940.1.39243 WP_000404940.1.39270 WP_000404940.1.3928 WP_000404940.1.39292 WP_000404940.1.39304 WP_000404940.1.39318 WP_000404940.1.3932 WP_000404940.1.39321 WP_000404940.1.39322 WP_000404940.1.39339 WP_000404940.1.3934 WP_000404940.1.39343 WP_000404940.1.39387 WP_000404940.1.3939 WP_000404940.1.39394 WP_000404940.1.39412 WP_000404940.1.39421 WP_000404940.1.39431 WP_000404940.1.39443 WP_000404940.1.395 WP_000404940.1.39505 WP_000404940.1.39518 WP_000404940.1.39533 WP_000404940.1.39568 WP_000404940.1.39569 WP_000404940.1.39585 WP_000404940.1.39591 WP_000404940.1.39596 WP_000404940.1.39597 WP_000404940.1.39648 WP_000404940.1.3966 WP_000404940.1.39663 WP_000404940.1.39710 WP_000404940.1.39719 WP_000404940.1.39731 WP_000404940.1.39736 WP_000404940.1.39754 WP_000404940.1.39793 WP_000404940.1.39824 WP_000404940.1.39828 WP_000404940.1.39833 WP_000404940.1.39872 WP_000404940.1.39886 WP_000404940.1.39931 WP_000404940.1.39944 WP_000404940.1.39948 WP_000404940.1.39978 WP_000404940.1.39985 WP_000404940.1.39990 WP_000404940.1.400 WP_000404940.1.40003 WP_000404940.1.40005 WP_000404940.1.40007 WP_000404940.1.40018 WP_000404940.1.40022 WP_000404940.1.40023 WP_000404940.1.40027 WP_000404940.1.40041 WP_000404940.1.4008 WP_000404940.1.40092 WP_000404940.1.40106 WP_000404940.1.40112 WP_000404940.1.40117 WP_000404940.1.40118 WP_000404940.1.40122 WP_000404940.1.40128 WP_000404940.1.40176 WP_000404940.1.40182 WP_000404940.1.40216 WP_000404940.1.4023 WP_000404940.1.40239 WP_000404940.1.40274 WP_000404940.1.40290 WP_000404940.1.40296 WP_000404940.1.40303 WP_000404940.1.40306 WP_000404940.1.40325 WP_000404940.1.40333 WP_000404940.1.40347 WP_000404940.1.40362 WP_000404940.1.40363 WP_000404940.1.40376 WP_000404940.1.40393 WP_000404940.1.40400 WP_000404940.1.40422 WP_000404940.1.40434 WP_000404940.1.40457 WP_000404940.1.40475 WP_000404940.1.40479 WP_000404940.1.40487 WP_000404940.1.40526 WP_000404940.1.40558 WP_000404940.1.40566 WP_000404940.1.40574 WP_000404940.1.40578 WP_000404940.1.4059 WP_000404940.1.40602 WP_000404940.1.40626 WP_000404940.1.40667 WP_000404940.1.40673 WP_000404940.1.40682 WP_000404940.1.40696 WP_000404940.1.40714 WP_000404940.1.40726 WP_000404940.1.40728 WP_000404940.1.40730 WP_000404940.1.40733 WP_000404940.1.40737 WP_000404940.1.40739 WP_000404940.1.40746 WP_000404940.1.40754 WP_000404940.1.40756 WP_000404940.1.40767 WP_000404940.1.40801 WP_000404940.1.40826 WP_000404940.1.40850 WP_000404940.1.40879 WP_000404940.1.40883 WP_000404940.1.40887 WP_000404940.1.40889 WP_000404940.1.40931 WP_000404940.1.4094 WP_000404940.1.40960 WP_000404940.1.40968 WP_000404940.1.40971 WP_000404940.1.40974 WP_000404940.1.40982 WP_000404940.1.40985 WP_000404940.1.40986 WP_000404940.1.41008 WP_000404940.1.41010 WP_000404940.1.41012 WP_000404940.1.41025 WP_000404940.1.41047 WP_000404940.1.41068 WP_000404940.1.41071 WP_000404940.1.41088 WP_000404940.1.4111 WP_000404940.1.41126 WP_000404940.1.41162 WP_000404940.1.41186 WP_000404940.1.41203 WP_000404940.1.41209 WP_000404940.1.41267 WP_000404940.1.41268 WP_000404940.1.41275 WP_000404940.1.41278 WP_000404940.1.41317 WP_000404940.1.41319 WP_000404940.1.41327 WP_000404940.1.41360 WP_000404940.1.41387 WP_000404940.1.41388 WP_000404940.1.4143 WP_000404940.1.41450 WP_000404940.1.41467 WP_000404940.1.4147 WP_000404940.1.41475 WP_000404940.1.41476 WP_000404940.1.415 WP_000404940.1.41508 WP_000404940.1.4152 WP_000404940.1.41527 WP_000404940.1.41551 WP_000404940.1.41586 WP_000404940.1.4159 WP_000404940.1.41652 WP_000404940.1.41684 WP_000404940.1.41697 WP_000404940.1.41737 WP_000404940.1.41739 WP_000404940.1.41757 WP_000404940.1.41763 WP_000404940.1.41775 WP_000404940.1.41787 WP_000404940.1.41801 WP_000404940.1.41808 WP_000404940.1.41823 WP_000404940.1.41850 WP_000404940.1.41892 WP_000404940.1.41902 WP_000404940.1.41914 WP_000404940.1.41932 WP_000404940.1.41937 WP_000404940.1.41958 WP_000404940.1.41961 WP_000404940.1.4201 WP_000404940.1.42021 WP_000404940.1.42024 WP_000404940.1.42030 WP_000404940.1.42034 WP_000404940.1.42086 WP_000404940.1.42099 WP_000404940.1.42100 WP_000404940.1.42106 WP_000404940.1.42140 WP_000404940.1.42149 WP_000404940.1.42173 WP_000404940.1.42195 WP_000404940.1.42204 WP_000404940.1.42229 WP_000404940.1.42232 WP_000404940.1.42266 WP_000404940.1.42275 WP_000404940.1.4230 WP_000404940.1.42303 WP_000404940.1.42315 WP_000404940.1.42331 WP_000404940.1.42337 WP_000404940.1.42348 WP_000404940.1.42358 WP_000404940.1.424 WP_000404940.1.42437 WP_000404940.1.42450 WP_000404940.1.42470 WP_000404940.1.4249 WP_000404940.1.42500 WP_000404940.1.4252 WP_000404940.1.42528 WP_000404940.1.42536 WP_000404940.1.42538 WP_000404940.1.42546 WP_000404940.1.42566 WP_000404940.1.42611 WP_000404940.1.42625 WP_000404940.1.42642 WP_000404940.1.427 WP_000404940.1.42715 WP_000404940.1.42741 WP_000404940.1.42743 WP_000404940.1.42760 WP_000404940.1.42792 WP_000404940.1.42807 WP_000404940.1.42817 WP_000404940.1.4283 WP_000404940.1.42846 WP_000404940.1.42906 WP_000404940.1.42911 WP_000404940.1.42933 WP_000404940.1.42935 WP_000404940.1.42938 WP_000404940.1.42964 WP_000404940.1.42965 WP_000404940.1.42969 WP_000404940.1.43012 WP_000404940.1.43015 WP_000404940.1.43017 WP_000404940.1.4302 WP_000404940.1.43029 WP_000404940.1.43045 WP_000404940.1.43051 WP_000404940.1.43059 WP_000404940.1.43066 WP_000404940.1.43074 WP_000404940.1.43085 WP_000404940.1.43101 WP_000404940.1.43109 WP_000404940.1.43119 WP_000404940.1.43150 WP_000404940.1.4317 WP_000404940.1.43186 WP_000404940.1.43191 WP_000404940.1.43192 WP_000404940.1.43197 WP_000404940.1.43205 WP_000404940.1.43207 WP_000404940.1.43210 WP_000404940.1.43219 WP_000404940.1.43229 WP_000404940.1.4328 WP_000404940.1.43300 WP_000404940.1.43302 WP_000404940.1.43343 WP_000404940.1.43344 WP_000404940.1.43347 WP_000404940.1.43361 WP_000404940.1.43367 WP_000404940.1.43390 WP_000404940.1.434 WP_000404940.1.43408 WP_000404940.1.43423 WP_000404940.1.43424 WP_000404940.1.43443 WP_000404940.1.43453 WP_000404940.1.43467 WP_000404940.1.43479 WP_000404940.1.43496 WP_000404940.1.43499 WP_000404940.1.43503 WP_000404940.1.43511 WP_000404940.1.43516 WP_000404940.1.43518 WP_000404940.1.43527 WP_000404940.1.43537 WP_000404940.1.43539 WP_000404940.1.43558 WP_000404940.1.4358 WP_000404940.1.43580 WP_000404940.1.43584 WP_000404940.1.43634 WP_000404940.1.4364 WP_000404940.1.43644 WP_000404940.1.43658 WP_000404940.1.4366 WP_000404940.1.43698 WP_000404940.1.43701 WP_000404940.1.43705 WP_000404940.1.43714 WP_000404940.1.43739 WP_000404940.1.43741 WP_000404940.1.43753 WP_000404940.1.43757 WP_000404940.1.43771 WP_000404940.1.43774 WP_000404940.1.43775 WP_000404940.1.43792 WP_000404940.1.43793 WP_000404940.1.43845 WP_000404940.1.43848 WP_000404940.1.43870 WP_000404940.1.43887 WP_000404940.1.43889 WP_000404940.1.43900 WP_000404940.1.43910 WP_000404940.1.43926 WP_000404940.1.43932 WP_000404940.1.43972 WP_000404940.1.44003 WP_000404940.1.44019 WP_000404940.1.44022 WP_000404940.1.44024 WP_000404940.1.44042 WP_000404940.1.44073 WP_000404940.1.44127 WP_000404940.1.44135 WP_000404940.1.44138 WP_000404940.1.44176 WP_000404940.1.44209 WP_000404940.1.44218 WP_000404940.1.44227 WP_000404940.1.4425 WP_000404940.1.4429 WP_000404940.1.44293 WP_000404940.1.44306 WP_000404940.1.44329 WP_000404940.1.44335 WP_000404940.1.44356 WP_000404940.1.44379 WP_000404940.1.44387 WP_000404940.1.44399 WP_000404940.1.44403 WP_000404940.1.4442 WP_000404940.1.44421 WP_000404940.1.44439 WP_000404940.1.44462 WP_000404940.1.44473 WP_000404940.1.44496 WP_000404940.1.44498 WP_000404940.1.44512 WP_000404940.1.44533 WP_000404940.1.44550 WP_000404940.1.4456 WP_000404940.1.44574 WP_000404940.1.44584 WP_000404940.1.44595 WP_000404940.1.44601 WP_000404940.1.44616 WP_000404940.1.44644 WP_000404940.1.44647 WP_000404940.1.44681 WP_000404940.1.44682 WP_000404940.1.44695 WP_000404940.1.44699 WP_000404940.1.44711 WP_000404940.1.44764 WP_000404940.1.44789 WP_000404940.1.44825 WP_000404940.1.44835 WP_000404940.1.44844 WP_000404940.1.44850 WP_000404940.1.44858 WP_000404940.1.44872 WP_000404940.1.44885 WP_000404940.1.44890 WP_000404940.1.44894 WP_000404940.1.4491 WP_000404940.1.44937 WP_000404940.1.44938 WP_000404940.1.44972 WP_000404940.1.44987 WP_000404940.1.44995 WP_000404940.1.45006 WP_000404940.1.45023 WP_000404940.1.45051 WP_000404940.1.45065 WP_000404940.1.45078 WP_000404940.1.45082 WP_000404940.1.45087 WP_000404940.1.45109 WP_000404940.1.45112 WP_000404940.1.45118 WP_000404940.1.4512 WP_000404940.1.45120 WP_000404940.1.45148 WP_000404940.1.45179 WP_000404940.1.45187 WP_000404940.1.45196 WP_000404940.1.45220 WP_000404940.1.45222 WP_000404940.1.45224 WP_000404940.1.45225 WP_000404940.1.45261 WP_000404940.1.45263 WP_000404940.1.45266 WP_000404940.1.45276 WP_000404940.1.45283 WP_000404940.1.45287 WP_000404940.1.45300 WP_000404940.1.45325 WP_000404940.1.45346 WP_000404940.1.45357 WP_000404940.1.4536 WP_000404940.1.45370 WP_000404940.1.45378 WP_000404940.1.45417 WP_000404940.1.45433 WP_000404940.1.4547 WP_000404940.1.45476 WP_000404940.1.45481 WP_000404940.1.45505 WP_000404940.1.45506 WP_000404940.1.45528 WP_000404940.1.45531 WP_000404940.1.45539 WP_000404940.1.4554 WP_000404940.1.4556 WP_000404940.1.45572 WP_000404940.1.4559 WP_000404940.1.45606 WP_000404940.1.45612 WP_000404940.1.45639 WP_000404940.1.45652 WP_000404940.1.4566 WP_000404940.1.45673 WP_000404940.1.45687 WP_000404940.1.45688 WP_000404940.1.45691 WP_000404940.1.45749 WP_000404940.1.45762 WP_000404940.1.45810 WP_000404940.1.45820 WP_000404940.1.45825 WP_000404940.1.45886 WP_000404940.1.45905 WP_000404940.1.45909 WP_000404940.1.45917 WP_000404940.1.45927 WP_000404940.1.45948 WP_000404940.1.45952 WP_000404940.1.45959 WP_000404940.1.45981 WP_000404940.1.45993 WP_000404940.1.45997 WP_000404940.1.46022 WP_000404940.1.46024 WP_000404940.1.46060 WP_000404940.1.46088 WP_000404940.1.46094 WP_000404940.1.46149 WP_000404940.1.46156 WP_000404940.1.46158 WP_000404940.1.46177 WP_000404940.1.46178 WP_000404940.1.46184 WP_000404940.1.46206 WP_000404940.1.4621 WP_000404940.1.46251 WP_000404940.1.46270 WP_000404940.1.46281 WP_000404940.1.46284 WP_000404940.1.4629 WP_000404940.1.46290 WP_000404940.1.46296 WP_000404940.1.46309 WP_000404940.1.46315 WP_000404940.1.46470 WP_000404940.1.46480 WP_000404940.1.46483 WP_000404940.1.46495 WP_000404940.1.46498 WP_000404940.1.46500 WP_000404940.1.46501 WP_000404940.1.4656 WP_000404940.1.46564 WP_000404940.1.46607 WP_000404940.1.4663 WP_000404940.1.46632 WP_000404940.1.46634 WP_000404940.1.46640 WP_000404940.1.46649 WP_000404940.1.46665 WP_000404940.1.4667 WP_000404940.1.46673 WP_000404940.1.46683 WP_000404940.1.46687 WP_000404940.1.46694 WP_000404940.1.46695 WP_000404940.1.46716 WP_000404940.1.46783 WP_000404940.1.46784 WP_000404940.1.46789 WP_000404940.1.46809 WP_000404940.1.46874 WP_000404940.1.46878 WP_000404940.1.46884 WP_000404940.1.46892 WP_000404940.1.46893 WP_000404940.1.469 WP_000404940.1.46901 WP_000404940.1.46915 WP_000404940.1.46919 WP_000404940.1.46927 WP_000404940.1.46934 WP_000404940.1.46955 WP_000404940.1.46966 WP_000404940.1.47004 WP_000404940.1.47033 WP_000404940.1.47043 WP_000404940.1.47045 WP_000404940.1.4707 WP_000404940.1.47076 WP_000404940.1.47091 WP_000404940.1.47099 WP_000404940.1.47103 WP_000404940.1.47114 WP_000404940.1.47176 WP_000404940.1.47256 WP_000404940.1.47272 WP_000404940.1.47288 WP_000404940.1.47327 WP_000404940.1.47338 WP_000404940.1.47351 WP_000404940.1.47365 WP_000404940.1.47394 WP_000404940.1.47409 WP_000404940.1.47415 WP_000404940.1.47420 WP_000404940.1.47444 WP_000404940.1.47452 WP_000404940.1.47462 WP_000404940.1.47466 WP_000404940.1.47483 WP_000404940.1.47490 WP_000404940.1.47526 WP_000404940.1.47569 WP_000404940.1.47595 WP_000404940.1.47596 WP_000404940.1.47633 WP_000404940.1.47635 WP_000404940.1.47651 WP_000404940.1.47657 WP_000404940.1.47699 WP_000404940.1.47712 WP_000404940.1.47766 WP_000404940.1.47771 WP_000404940.1.47781 WP_000404940.1.47785 WP_000404940.1.47806 WP_000404940.1.47819 WP_000404940.1.47833 WP_000404940.1.47853 WP_000404940.1.47860 WP_000404940.1.4789 WP_000404940.1.47890 WP_000404940.1.4790 WP_000404940.1.47923 WP_000404940.1.47973 WP_000404940.1.47977 WP_000404940.1.4798 WP_000404940.1.48031 WP_000404940.1.48037 WP_000404940.1.4804 WP_000404940.1.48043 WP_000404940.1.48060 WP_000404940.1.48089 WP_000404940.1.48112 WP_000404940.1.48118 WP_000404940.1.48122 WP_000404940.1.48137 WP_000404940.1.48148 WP_000404940.1.4817 WP_000404940.1.48171 WP_000404940.1.48213 WP_000404940.1.4822 WP_000404940.1.48232 WP_000404940.1.48257 WP_000404940.1.48309 WP_000404940.1.4832 WP_000404940.1.48339 WP_000404940.1.48349 WP_000404940.1.48381 WP_000404940.1.48384 WP_000404940.1.48387 WP_000404940.1.48395 WP_000404940.1.48420 WP_000404940.1.48447 WP_000404940.1.48468 WP_000404940.1.48481 WP_000404940.1.48498 WP_000404940.1.48504 WP_000404940.1.48511 WP_000404940.1.48533 WP_000404940.1.48604 WP_000404940.1.48613 WP_000404940.1.48614 WP_000404940.1.48625 WP_000404940.1.48627 WP_000404940.1.48669 WP_000404940.1.48698 WP_000404940.1.48713 WP_000404940.1.48718 WP_000404940.1.48731 WP_000404940.1.48758 WP_000404940.1.48762 WP_000404940.1.48767 WP_000404940.1.48799 WP_000404940.1.48800 WP_000404940.1.4882 WP_000404940.1.48828 WP_000404940.1.48867 WP_000404940.1.48890 WP_000404940.1.48892 WP_000404940.1.4894 WP_000404940.1.48944 WP_000404940.1.4895 WP_000404940.1.48986 WP_000404940.1.48998 WP_000404940.1.490 WP_000404940.1.49008 WP_000404940.1.49025 WP_000404940.1.49033 WP_000404940.1.49038 WP_000404940.1.49050 WP_000404940.1.49060 WP_000404940.1.49074 WP_000404940.1.49075 WP_000404940.1.49115 WP_000404940.1.49119 WP_000404940.1.49122 WP_000404940.1.49130 WP_000404940.1.49178 WP_000404940.1.492 WP_000404940.1.49208 WP_000404940.1.49213 WP_000404940.1.49216 WP_000404940.1.49232 WP_000404940.1.49268 WP_000404940.1.49283 WP_000404940.1.49303 WP_000404940.1.49324 WP_000404940.1.4933 WP_000404940.1.4934 WP_000404940.1.49354 WP_000404940.1.4936 WP_000404940.1.49385 WP_000404940.1.49389 WP_000404940.1.49407 WP_000404940.1.49408 WP_000404940.1.4951 WP_000404940.1.49510 WP_000404940.1.49511 WP_000404940.1.49514 WP_000404940.1.49538 WP_000404940.1.49571 WP_000404940.1.49587 WP_000404940.1.49597 WP_000404940.1.4960 WP_000404940.1.49600 WP_000404940.1.49601 WP_000404940.1.49627 WP_000404940.1.49628 WP_000404940.1.49635 WP_000404940.1.49636 WP_000404940.1.49692 WP_000404940.1.49752 WP_000404940.1.49759 WP_000404940.1.49765 WP_000404940.1.49776 WP_000404940.1.49785 WP_000404940.1.49801 WP_000404940.1.49824 WP_000404940.1.49840 WP_000404940.1.49841 WP_000404940.1.49845 WP_000404940.1.49873 WP_000404940.1.49874 WP_000404940.1.49881 WP_000404940.1.49889 WP_000404940.1.49904 WP_000404940.1.49955 WP_000404940.1.49964 WP_000404940.1.49975 WP_000404940.1.50005 WP_000404940.1.50016 WP_000404940.1.50034 WP_000404940.1.50048 WP_000404940.1.50059 WP_000404940.1.50070 WP_000404940.1.50083 WP_000404940.1.50089 WP_000404940.1.50094 WP_000404940.1.50105 WP_000404940.1.50107 WP_000404940.1.50108 WP_000404940.1.50120 WP_000404940.1.50129 WP_000404940.1.50134 WP_000404940.1.50139 WP_000404940.1.50143 WP_000404940.1.50151 WP_000404940.1.50168 WP_000404940.1.50169 WP_000404940.1.50200 WP_000404940.1.5022 WP_000404940.1.50234 WP_000404940.1.50244 WP_000404940.1.50246 WP_000404940.1.50263 WP_000404940.1.50275 WP_000404940.1.50281 WP_000404940.1.50305 WP_000404940.1.50315 WP_000404940.1.50318 WP_000404940.1.50396 WP_000404940.1.50422 WP_000404940.1.50442 WP_000404940.1.50454 WP_000404940.1.50467 WP_000404940.1.50474 WP_000404940.1.50489 WP_000404940.1.50501 WP_000404940.1.50530 WP_000404940.1.50532 WP_000404940.1.50580 WP_000404940.1.50582 WP_000404940.1.5060 WP_000404940.1.50606 WP_000404940.1.50615 WP_000404940.1.50621 WP_000404940.1.50628 WP_000404940.1.50637 WP_000404940.1.50649 WP_000404940.1.5065 WP_000404940.1.50657 WP_000404940.1.50664 WP_000404940.1.50685 WP_000404940.1.507 WP_000404940.1.50709 WP_000404940.1.50739 WP_000404940.1.50743 WP_000404940.1.50785 WP_000404940.1.50797 WP_000404940.1.50821 WP_000404940.1.50824 WP_000404940.1.50835 WP_000404940.1.50836 WP_000404940.1.50838 WP_000404940.1.50843 WP_000404940.1.50846 WP_000404940.1.50849 WP_000404940.1.50870 WP_000404940.1.50879 WP_000404940.1.50911 WP_000404940.1.50915 WP_000404940.1.50921 WP_000404940.1.50948 WP_000404940.1.50965 WP_000404940.1.50978 WP_000404940.1.50985 WP_000404940.1.50995 WP_000404940.1.51012 WP_000404940.1.51032 WP_000404940.1.51054 WP_000404940.1.51075 WP_000404940.1.51079 WP_000404940.1.51083 WP_000404940.1.51089 WP_000404940.1.51094 WP_000404940.1.51096 WP_000404940.1.51098 WP_000404940.1.51110 WP_000404940.1.51145 WP_000404940.1.5116 WP_000404940.1.51188 WP_000404940.1.51205 WP_000404940.1.51218 WP_000404940.1.5122 WP_000404940.1.51237 WP_000404940.1.51243 WP_000404940.1.51249 WP_000404940.1.51316 WP_000404940.1.5134 WP_000404940.1.51357 WP_000404940.1.51367 WP_000404940.1.51379 WP_000404940.1.51417 WP_000404940.1.51420 WP_000404940.1.51439 WP_000404940.1.51444 WP_000404940.1.51449 WP_000404940.1.51467 WP_000404940.1.51470 WP_000404940.1.51475 WP_000404940.1.51504 WP_000404940.1.51507 WP_000404940.1.51511 WP_000404940.1.51528 WP_000404940.1.51533 WP_000404940.1.51541 WP_000404940.1.51546 WP_000404940.1.51554 WP_000404940.1.51562 WP_000404940.1.51602 WP_000404940.1.51635 WP_000404940.1.51658 WP_000404940.1.5166 WP_000404940.1.51673 WP_000404940.1.51674 WP_000404940.1.51684 WP_000404940.1.5169 WP_000404940.1.51715 WP_000404940.1.51726 WP_000404940.1.51742 WP_000404940.1.51776 WP_000404940.1.51806 WP_000404940.1.51809 WP_000404940.1.51820 WP_000404940.1.51826 WP_000404940.1.51830 WP_000404940.1.51835 WP_000404940.1.51855 WP_000404940.1.5188 WP_000404940.1.51893 WP_000404940.1.51908 WP_000404940.1.51960 WP_000404940.1.51983 WP_000404940.1.52004 WP_000404940.1.52014 WP_000404940.1.52018 WP_000404940.1.5204 WP_000404940.1.52042 WP_000404940.1.52049 WP_000404940.1.52055 WP_000404940.1.52060 WP_000404940.1.52064 WP_000404940.1.5207 WP_000404940.1.52107 WP_000404940.1.52116 WP_000404940.1.5212 WP_000404940.1.52143 WP_000404940.1.52157 WP_000404940.1.52228 WP_000404940.1.52245 WP_000404940.1.52263 WP_000404940.1.52268 WP_000404940.1.52276 WP_000404940.1.52315 WP_000404940.1.52319 WP_000404940.1.52323 WP_000404940.1.52335 WP_000404940.1.52386 WP_000404940.1.52412 WP_000404940.1.5244 WP_000404940.1.52443 WP_000404940.1.52512 WP_000404940.1.52515 WP_000404940.1.52540 WP_000404940.1.52551 WP_000404940.1.5256 WP_000404940.1.52561 WP_000404940.1.52570 WP_000404940.1.52581 WP_000404940.1.52600 WP_000404940.1.5261 WP_000404940.1.52666 WP_000404940.1.52681 WP_000404940.1.52721 WP_000404940.1.52726 WP_000404940.1.52759 WP_000404940.1.52770 WP_000404940.1.52783 WP_000404940.1.52786 WP_000404940.1.52788 WP_000404940.1.52842 WP_000404940.1.52843 WP_000404940.1.52854 WP_000404940.1.52856 WP_000404940.1.52879 WP_000404940.1.52896 WP_000404940.1.52953 WP_000404940.1.52957 WP_000404940.1.52972 WP_000404940.1.52975 WP_000404940.1.52977 WP_000404940.1.52978 WP_000404940.1.5298 WP_000404940.1.52987 WP_000404940.1.52988 WP_000404940.1.52994 WP_000404940.1.53004 WP_000404940.1.53010 WP_000404940.1.53040 WP_000404940.1.53054 WP_000404940.1.53068 WP_000404940.1.53135 WP_000404940.1.53149 WP_000404940.1.53166 WP_000404940.1.53183 WP_000404940.1.53205 WP_000404940.1.53212 WP_000404940.1.53235 WP_000404940.1.53239 WP_000404940.1.53241 WP_000404940.1.53243 WP_000404940.1.53249 WP_000404940.1.53268 WP_000404940.1.53275 WP_000404940.1.53291 WP_000404940.1.53297 WP_000404940.1.53320 WP_000404940.1.53337 WP_000404940.1.53339 WP_000404940.1.53340 WP_000404940.1.53355 WP_000404940.1.53357 WP_000404940.1.53365 WP_000404940.1.53380 WP_000404940.1.53384 WP_000404940.1.53405 WP_000404940.1.53420 WP_000404940.1.53430 WP_000404940.1.53449 WP_000404940.1.5348 WP_000404940.1.53499 WP_000404940.1.53524 WP_000404940.1.53547 WP_000404940.1.53581 WP_000404940.1.53596 WP_000404940.1.53600 WP_000404940.1.5361 WP_000404940.1.53611 WP_000404940.1.53612 WP_000404940.1.53619 WP_000404940.1.53622 WP_000404940.1.53633 WP_000404940.1.53640 WP_000404940.1.53660 WP_000404940.1.53677 WP_000404940.1.53697 WP_000404940.1.53699 WP_000404940.1.53735 WP_000404940.1.53761 WP_000404940.1.53773 WP_000404940.1.53785 WP_000404940.1.53789 WP_000404940.1.53797 WP_000404940.1.53798 WP_000404940.1.53820 WP_000404940.1.5385 WP_000404940.1.53871 WP_000404940.1.53891 WP_000404940.1.53929 WP_000404940.1.53950 WP_000404940.1.53957 WP_000404940.1.5396 WP_000404940.1.54001 WP_000404940.1.54009 WP_000404940.1.54020 WP_000404940.1.54027 WP_000404940.1.5405 WP_000404940.1.54050 WP_000404940.1.54064 WP_000404940.1.54065 WP_000404940.1.54066 WP_000404940.1.54069 WP_000404940.1.5411 WP_000404940.1.54110 WP_000404940.1.54130 WP_000404940.1.54154 WP_000404940.1.54163 WP_000404940.1.5418 WP_000404940.1.54183 WP_000404940.1.54187 WP_000404940.1.54214 WP_000404940.1.54221 WP_000404940.1.5424 WP_000404940.1.543 WP_000404940.1.54303 WP_000404940.1.5431 WP_000404940.1.54334 WP_000404940.1.54337 WP_000404940.1.54349 WP_000404940.1.54372 WP_000404940.1.54376 WP_000404940.1.54401 WP_000404940.1.54402 WP_000404940.1.54412 WP_000404940.1.54424 WP_000404940.1.54457 WP_000404940.1.54458 WP_000404940.1.54473 WP_000404940.1.54475 WP_000404940.1.54483 WP_000404940.1.54501 WP_000404940.1.54515 WP_000404940.1.54529 WP_000404940.1.5453 WP_000404940.1.54549 WP_000404940.1.54559 WP_000404940.1.54563 WP_000404940.1.54570 WP_000404940.1.54576 WP_000404940.1.54582 WP_000404940.1.54610 WP_000404940.1.54650 WP_000404940.1.54656 WP_000404940.1.54658 WP_000404940.1.54680 WP_000404940.1.54697 WP_000404940.1.54738 WP_000404940.1.54762 WP_000404940.1.5477 WP_000404940.1.54793 WP_000404940.1.54796 WP_000404940.1.54805 WP_000404940.1.54810 WP_000404940.1.54840 WP_000404940.1.54848 WP_000404940.1.54862 WP_000404940.1.54872 WP_000404940.1.54894 WP_000404940.1.54922 WP_000404940.1.54932 WP_000404940.1.54938 WP_000404940.1.5495 WP_000404940.1.54960 WP_000404940.1.54971 WP_000404940.1.54997 WP_000404940.1.550 WP_000404940.1.55035 WP_000404940.1.55039 WP_000404940.1.5504 WP_000404940.1.55053 WP_000404940.1.55066 WP_000404940.1.55071 WP_000404940.1.55079 WP_000404940.1.55087 WP_000404940.1.55091 WP_000404940.1.55093 WP_000404940.1.55107 WP_000404940.1.55110 WP_000404940.1.55143 WP_000404940.1.55148 WP_000404940.1.55154 WP_000404940.1.55183 WP_000404940.1.55207 WP_000404940.1.55211 WP_000404940.1.55217 WP_000404940.1.55256 WP_000404940.1.55259 WP_000404940.1.55262 WP_000404940.1.55277 WP_000404940.1.5528 WP_000404940.1.55292 WP_000404940.1.55298 WP_000404940.1.55299 WP_000404940.1.55314 WP_000404940.1.55331 WP_000404940.1.55332 WP_000404940.1.55360 WP_000404940.1.55362 WP_000404940.1.5537 WP_000404940.1.55385 WP_000404940.1.55388 WP_000404940.1.55409 WP_000404940.1.55426 WP_000404940.1.55438 WP_000404940.1.55474 WP_000404940.1.55479 WP_000404940.1.55499 WP_000404940.1.55502 WP_000404940.1.55523 WP_000404940.1.55525 WP_000404940.1.55531 WP_000404940.1.55532 WP_000404940.1.55534 WP_000404940.1.55561 WP_000404940.1.55566 WP_000404940.1.55587 WP_000404940.1.55594 WP_000404940.1.55605 WP_000404940.1.55654 WP_000404940.1.55677 WP_000404940.1.55685 WP_000404940.1.55711 WP_000404940.1.55722 WP_000404940.1.55726 WP_000404940.1.55733 WP_000404940.1.55736 WP_000404940.1.55756 WP_000404940.1.55761 WP_000404940.1.55763 WP_000404940.1.5578 WP_000404940.1.55810 WP_000404940.1.55836 WP_000404940.1.5586 WP_000404940.1.55861 WP_000404940.1.55879 WP_000404940.1.55881 WP_000404940.1.55889 WP_000404940.1.55903 WP_000404940.1.55906 WP_000404940.1.55918 WP_000404940.1.55947 WP_000404940.1.55969 WP_000404940.1.55978 WP_000404940.1.55980 WP_000404940.1.5599 WP_000404940.1.560 WP_000404940.1.56022 WP_000404940.1.56023 WP_000404940.1.56041 WP_000404940.1.56112 WP_000404940.1.56124 WP_000404940.1.56136 WP_000404940.1.5615 WP_000404940.1.56155 WP_000404940.1.56185 WP_000404940.1.56250 WP_000404940.1.56257 WP_000404940.1.56266 WP_000404940.1.56300 WP_000404940.1.56316 WP_000404940.1.56319 WP_000404940.1.56326 WP_000404940.1.56378 WP_000404940.1.56408 WP_000404940.1.56427 WP_000404940.1.56461 WP_000404940.1.56472 WP_000404940.1.56476 WP_000404940.1.56477 WP_000404940.1.56505 WP_000404940.1.56515 WP_000404940.1.56518 WP_000404940.1.5652 WP_000404940.1.56568 WP_000404940.1.56581 WP_000404940.1.56582 WP_000404940.1.56605 WP_000404940.1.56610 WP_000404940.1.56617 WP_000404940.1.56624 WP_000404940.1.5663 WP_000404940.1.56653 WP_000404940.1.56667 WP_000404940.1.56676 WP_000404940.1.56678 WP_000404940.1.56746 WP_000404940.1.56756 WP_000404940.1.56775 WP_000404940.1.56790 WP_000404940.1.56867 WP_000404940.1.56881 WP_000404940.1.56884 WP_000404940.1.5689 WP_000404940.1.56913 WP_000404940.1.56958 WP_000404940.1.56989 WP_000404940.1.56995 WP_000404940.1.57001 WP_000404940.1.57004 WP_000404940.1.57009 WP_000404940.1.57013 WP_000404940.1.57017 WP_000404940.1.57037 WP_000404940.1.57044 WP_000404940.1.5708 WP_000404940.1.57089 WP_000404940.1.5710 WP_000404940.1.57103 WP_000404940.1.57119 WP_000404940.1.57127 WP_000404940.1.57194 WP_000404940.1.57219 WP_000404940.1.57235 WP_000404940.1.57279 WP_000404940.1.57303 WP_000404940.1.57334 WP_000404940.1.57366 WP_000404940.1.57382 WP_000404940.1.57384 WP_000404940.1.57419 WP_000404940.1.57442 WP_000404940.1.57446 WP_000404940.1.57472 WP_000404940.1.57490 WP_000404940.1.57508 WP_000404940.1.57530 WP_000404940.1.5757 WP_000404940.1.57587 WP_000404940.1.57611 WP_000404940.1.57647 WP_000404940.1.57668 WP_000404940.1.57677 WP_000404940.1.57687 WP_000404940.1.57691 WP_000404940.1.57725 WP_000404940.1.57726 WP_000404940.1.57743 WP_000404940.1.57750 WP_000404940.1.57753 WP_000404940.1.57760 WP_000404940.1.57777 WP_000404940.1.57780 WP_000404940.1.57787 WP_000404940.1.57789 WP_000404940.1.5779 WP_000404940.1.578 WP_000404940.1.57816 WP_000404940.1.57822 WP_000404940.1.57867 WP_000404940.1.57876 WP_000404940.1.57882 WP_000404940.1.57892 WP_000404940.1.57917 WP_000404940.1.57922 WP_000404940.1.5793 WP_000404940.1.57949 WP_000404940.1.57977 WP_000404940.1.5800 WP_000404940.1.58013 WP_000404940.1.58020 WP_000404940.1.58021 WP_000404940.1.5803 WP_000404940.1.58032 WP_000404940.1.58034 WP_000404940.1.58039 WP_000404940.1.58063 WP_000404940.1.58070 WP_000404940.1.58076 WP_000404940.1.5808 WP_000404940.1.58095 WP_000404940.1.581 WP_000404940.1.58124 WP_000404940.1.5813 WP_000404940.1.58166 WP_000404940.1.58171 WP_000404940.1.58181 WP_000404940.1.5819 WP_000404940.1.58196 WP_000404940.1.58197 WP_000404940.1.58217 WP_000404940.1.58225 WP_000404940.1.58227 WP_000404940.1.58243 WP_000404940.1.58296 WP_000404940.1.58331 WP_000404940.1.58333 WP_000404940.1.58342 WP_000404940.1.58344 WP_000404940.1.58348 WP_000404940.1.5835 WP_000404940.1.58361 WP_000404940.1.58376 WP_000404940.1.58402 WP_000404940.1.58404 WP_000404940.1.58434 WP_000404940.1.58437 WP_000404940.1.58458 WP_000404940.1.58474 WP_000404940.1.58480 WP_000404940.1.58483 WP_000404940.1.58492 WP_000404940.1.58519 WP_000404940.1.58522 WP_000404940.1.58553 WP_000404940.1.58563 WP_000404940.1.58574 WP_000404940.1.58591 WP_000404940.1.58595 WP_000404940.1.58607 WP_000404940.1.58627 WP_000404940.1.58642 WP_000404940.1.58646 WP_000404940.1.58653 WP_000404940.1.58670 WP_000404940.1.58679 WP_000404940.1.58684 WP_000404940.1.58697 WP_000404940.1.58700 WP_000404940.1.58717 WP_000404940.1.58761 WP_000404940.1.58762 WP_000404940.1.58811 WP_000404940.1.58825 WP_000404940.1.58829 WP_000404940.1.58841 WP_000404940.1.58843 WP_000404940.1.58854 WP_000404940.1.5887 WP_000404940.1.58877 WP_000404940.1.5892 WP_000404940.1.58948 WP_000404940.1.58959 WP_000404940.1.59001 WP_000404940.1.59018 WP_000404940.1.59028 WP_000404940.1.59033 WP_000404940.1.59065 WP_000404940.1.59066 WP_000404940.1.59081 WP_000404940.1.59109 WP_000404940.1.59117 WP_000404940.1.59137 WP_000404940.1.59141 WP_000404940.1.5916 WP_000404940.1.59198 WP_000404940.1.5921 WP_000404940.1.59215 WP_000404940.1.59229 WP_000404940.1.59235 WP_000404940.1.59242 WP_000404940.1.59268 WP_000404940.1.59307 WP_000404940.1.59308 WP_000404940.1.5934 WP_000404940.1.59365 WP_000404940.1.59367 WP_000404940.1.59370 WP_000404940.1.59382 WP_000404940.1.5941 WP_000404940.1.59424 WP_000404940.1.59435 WP_000404940.1.59437 WP_000404940.1.59442 WP_000404940.1.59468 WP_000404940.1.59482 WP_000404940.1.59497 WP_000404940.1.59514 WP_000404940.1.59527 WP_000404940.1.59532 WP_000404940.1.59534 WP_000404940.1.59552 WP_000404940.1.59558 WP_000404940.1.59589 WP_000404940.1.59606 WP_000404940.1.59608 WP_000404940.1.59637 WP_000404940.1.5964 WP_000404940.1.59642 WP_000404940.1.59673 WP_000404940.1.59676 WP_000404940.1.59700 WP_000404940.1.59740 WP_000404940.1.5976 WP_000404940.1.59766 WP_000404940.1.59774 WP_000404940.1.59785 WP_000404940.1.59859 WP_000404940.1.59867 WP_000404940.1.59883 WP_000404940.1.59895 WP_000404940.1.59903 WP_000404940.1.59906 WP_000404940.1.59935 WP_000404940.1.59938 WP_000404940.1.6001 WP_000404940.1.60014 WP_000404940.1.60032 WP_000404940.1.60073 WP_000404940.1.60078 WP_000404940.1.60083 WP_000404940.1.60105 WP_000404940.1.60148 WP_000404940.1.60174 WP_000404940.1.60177 WP_000404940.1.60180 WP_000404940.1.60188 WP_000404940.1.60204 WP_000404940.1.60210 WP_000404940.1.60256 WP_000404940.1.60298 WP_000404940.1.60303 WP_000404940.1.60384 WP_000404940.1.60385 WP_000404940.1.60388 WP_000404940.1.60391 WP_000404940.1.60420 WP_000404940.1.60423 WP_000404940.1.60438 WP_000404940.1.6044 WP_000404940.1.60450 WP_000404940.1.6046 WP_000404940.1.60485 WP_000404940.1.60513 WP_000404940.1.60521 WP_000404940.1.60529 WP_000404940.1.60532 WP_000404940.1.60574 WP_000404940.1.60590 WP_000404940.1.60592 WP_000404940.1.60596 WP_000404940.1.60601 WP_000404940.1.60615 WP_000404940.1.60618 WP_000404940.1.60621 WP_000404940.1.6063 WP_000404940.1.60637 WP_000404940.1.60642 WP_000404940.1.60645 WP_000404940.1.60656 WP_000404940.1.60670 WP_000404940.1.60693 WP_000404940.1.60723 WP_000404940.1.60731 WP_000404940.1.60737 WP_000404940.1.60755 WP_000404940.1.60756 WP_000404940.1.6079 WP_000404940.1.6081 WP_000404940.1.60812 WP_000404940.1.60815 WP_000404940.1.60867 WP_000404940.1.6087 WP_000404940.1.6088 WP_000404940.1.60886 WP_000404940.1.60911 WP_000404940.1.6092 WP_000404940.1.60924 WP_000404940.1.60961 WP_000404940.1.60973 WP_000404940.1.60977 WP_000404940.1.60985 WP_000404940.1.60993 WP_000404940.1.60996 WP_000404940.1.61021 WP_000404940.1.61028 WP_000404940.1.61043 WP_000404940.1.61151 WP_000404940.1.61155 WP_000404940.1.61159 WP_000404940.1.61160 WP_000404940.1.61164 WP_000404940.1.61194 WP_000404940.1.61208 WP_000404940.1.61214 WP_000404940.1.61217 WP_000404940.1.61220 WP_000404940.1.61226 WP_000404940.1.61250 WP_000404940.1.61254 WP_000404940.1.61278 WP_000404940.1.6128 WP_000404940.1.61301 WP_000404940.1.61302 WP_000404940.1.61307 WP_000404940.1.61348 WP_000404940.1.61363 WP_000404940.1.61365 WP_000404940.1.6137 WP_000404940.1.61372 WP_000404940.1.61378 WP_000404940.1.61396 WP_000404940.1.6140 WP_000404940.1.61404 WP_000404940.1.61405 WP_000404940.1.61423 WP_000404940.1.61451 WP_000404940.1.61460 WP_000404940.1.61506 WP_000404940.1.61513 WP_000404940.1.61514 WP_000404940.1.61546 WP_000404940.1.61548 WP_000404940.1.61550 WP_000404940.1.61560 WP_000404940.1.61568 WP_000404940.1.61606 WP_000404940.1.61611 WP_000404940.1.61627 WP_000404940.1.61632 WP_000404940.1.61647 WP_000404940.1.61651 WP_000404940.1.61700 WP_000404940.1.61731 WP_000404940.1.61733 WP_000404940.1.61735 WP_000404940.1.61751 WP_000404940.1.61765 WP_000404940.1.6177 WP_000404940.1.61785 WP_000404940.1.61801 WP_000404940.1.61807 WP_000404940.1.6183 WP_000404940.1.61837 WP_000404940.1.61845 WP_000404940.1.61848 WP_000404940.1.61863 WP_000404940.1.61882 WP_000404940.1.61896 WP_000404940.1.61912 WP_000404940.1.61916 WP_000404940.1.6192 WP_000404940.1.61954 WP_000404940.1.61959 WP_000404940.1.61992 WP_000404940.1.62001 WP_000404940.1.62006 WP_000404940.1.62022 WP_000404940.1.62039 WP_000404940.1.62062 WP_000404940.1.6207 WP_000404940.1.62114 WP_000404940.1.62118 WP_000404940.1.62129 WP_000404940.1.62134 WP_000404940.1.62137 WP_000404940.1.62145 WP_000404940.1.62151 WP_000404940.1.62161 WP_000404940.1.62167 WP_000404940.1.62173 WP_000404940.1.62190 WP_000404940.1.62197 WP_000404940.1.62216 WP_000404940.1.62220 WP_000404940.1.62235 WP_000404940.1.62283 WP_000404940.1.62287 WP_000404940.1.62293 WP_000404940.1.62315 WP_000404940.1.6235 WP_000404940.1.62356 WP_000404940.1.62390 WP_000404940.1.62391 WP_000404940.1.62394 WP_000404940.1.62420 WP_000404940.1.62421 WP_000404940.1.62432 WP_000404940.1.62434 WP_000404940.1.62444 WP_000404940.1.62445 WP_000404940.1.62465 WP_000404940.1.62518 WP_000404940.1.62521 WP_000404940.1.62528 WP_000404940.1.62540 WP_000404940.1.62546 WP_000404940.1.62558 WP_000404940.1.62559 WP_000404940.1.62566 WP_000404940.1.6258 WP_000404940.1.62581 WP_000404940.1.62583 WP_000404940.1.62585 WP_000404940.1.62600 WP_000404940.1.62607 WP_000404940.1.62613 WP_000404940.1.62615 WP_000404940.1.62643 WP_000404940.1.62667 WP_000404940.1.62670 WP_000404940.1.62777 WP_000404940.1.62779 WP_000404940.1.6279 WP_000404940.1.62799 WP_000404940.1.62803 WP_000404940.1.62814 WP_000404940.1.62821 WP_000404940.1.62833 WP_000404940.1.62836 WP_000404940.1.62862 WP_000404940.1.62867 WP_000404940.1.6288 WP_000404940.1.62889 WP_000404940.1.62900 WP_000404940.1.62921 WP_000404940.1.62944 WP_000404940.1.62969 WP_000404940.1.62994 WP_000404940.1.63029 WP_000404940.1.63033 WP_000404940.1.6306 WP_000404940.1.63067 WP_000404940.1.63075 WP_000404940.1.63077 WP_000404940.1.6309 WP_000404940.1.63149 WP_000404940.1.63165 WP_000404940.1.63191 WP_000404940.1.63214 WP_000404940.1.63225 WP_000404940.1.63230 WP_000404940.1.63235 WP_000404940.1.6324 WP_000404940.1.63245 WP_000404940.1.63311 WP_000404940.1.63328 WP_000404940.1.63329 WP_000404940.1.63375 WP_000404940.1.6341 WP_000404940.1.63431 WP_000404940.1.63442 WP_000404940.1.63468 WP_000404940.1.63473 WP_000404940.1.63503 WP_000404940.1.63506 WP_000404940.1.63544 WP_000404940.1.63587 WP_000404940.1.63621 WP_000404940.1.63675 WP_000404940.1.63724 WP_000404940.1.63741 WP_000404940.1.63753 WP_000404940.1.63761 WP_000404940.1.63762 WP_000404940.1.63767 WP_000404940.1.63778 WP_000404940.1.63787 WP_000404940.1.63788 WP_000404940.1.63792 WP_000404940.1.63846 WP_000404940.1.63859 WP_000404940.1.63882 WP_000404940.1.63891 WP_000404940.1.63893 WP_000404940.1.63919 WP_000404940.1.63920 WP_000404940.1.63927 WP_000404940.1.6393 WP_000404940.1.63931 WP_000404940.1.63936 WP_000404940.1.63938 WP_000404940.1.63971 WP_000404940.1.63988 WP_000404940.1.64002 WP_000404940.1.64090 WP_000404940.1.6410 WP_000404940.1.64113 WP_000404940.1.64126 WP_000404940.1.64132 WP_000404940.1.6414 WP_000404940.1.64163 WP_000404940.1.64167 WP_000404940.1.64184 WP_000404940.1.64203 WP_000404940.1.64224 WP_000404940.1.64225 WP_000404940.1.64245 WP_000404940.1.64246 WP_000404940.1.64255 WP_000404940.1.64262 WP_000404940.1.64267 WP_000404940.1.64269 WP_000404940.1.64313 WP_000404940.1.64316 WP_000404940.1.64320 WP_000404940.1.64322 WP_000404940.1.64338 WP_000404940.1.64342 WP_000404940.1.64359 WP_000404940.1.64373 WP_000404940.1.64401 WP_000404940.1.64423 WP_000404940.1.64464 WP_000404940.1.6447 WP_000404940.1.64481 WP_000404940.1.64490 WP_000404940.1.64572 WP_000404940.1.64576 WP_000404940.1.64653 WP_000404940.1.6467 WP_000404940.1.64679 WP_000404940.1.6470 WP_000404940.1.64700 WP_000404940.1.64719 WP_000404940.1.64725 WP_000404940.1.64728 WP_000404940.1.64734 WP_000404940.1.64739 WP_000404940.1.6474 WP_000404940.1.64750 WP_000404940.1.64756 WP_000404940.1.64778 WP_000404940.1.64782 WP_000404940.1.64785 WP_000404940.1.64815 WP_000404940.1.64824 WP_000404940.1.64837 WP_000404940.1.64839 WP_000404940.1.6485 WP_000404940.1.64851 WP_000404940.1.64867 WP_000404940.1.64871 WP_000404940.1.64876 WP_000404940.1.64890 WP_000404940.1.649 WP_000404940.1.64906 WP_000404940.1.64913 WP_000404940.1.64917 WP_000404940.1.64923 WP_000404940.1.64925 WP_000404940.1.64931 WP_000404940.1.6495 WP_000404940.1.64960 WP_000404940.1.6498 WP_000404940.1.64993 WP_000404940.1.65031 WP_000404940.1.6504 WP_000404940.1.6505 WP_000404940.1.65062 WP_000404940.1.65087 WP_000404940.1.65091 WP_000404940.1.65107 WP_000404940.1.65119 WP_000404940.1.65126 WP_000404940.1.65133 WP_000404940.1.6515 WP_000404940.1.65159 WP_000404940.1.65232 WP_000404940.1.65235 WP_000404940.1.65265 WP_000404940.1.65268 WP_000404940.1.65277 WP_000404940.1.6529 WP_000404940.1.65307 WP_000404940.1.65319 WP_000404940.1.6532 WP_000404940.1.65339 WP_000404940.1.65344 WP_000404940.1.65352 WP_000404940.1.65362 WP_000404940.1.65368 WP_000404940.1.65371 WP_000404940.1.6538 WP_000404940.1.65380 WP_000404940.1.65396 WP_000404940.1.65418 WP_000404940.1.65442 WP_000404940.1.65452 WP_000404940.1.65476 WP_000404940.1.65485 WP_000404940.1.65489 WP_000404940.1.65492 WP_000404940.1.65523 WP_000404940.1.65537 WP_000404940.1.65542 WP_000404940.1.65568 WP_000404940.1.65577 WP_000404940.1.65587 WP_000404940.1.65607 WP_000404940.1.65641 WP_000404940.1.65657 WP_000404940.1.65690 WP_000404940.1.65702 WP_000404940.1.65709 WP_000404940.1.65721 WP_000404940.1.65742 WP_000404940.1.65743 WP_000404940.1.6577 WP_000404940.1.65773 WP_000404940.1.65789 WP_000404940.1.65792 WP_000404940.1.65797 WP_000404940.1.65799 WP_000404940.1.658 WP_000404940.1.65806 WP_000404940.1.65814 WP_000404940.1.65829 WP_000404940.1.65859 WP_000404940.1.65887 WP_000404940.1.65896 WP_000404940.1.65897 WP_000404940.1.65920 WP_000404940.1.65944 WP_000404940.1.65960 WP_000404940.1.65971 WP_000404940.1.65982 WP_000404940.1.66006 WP_000404940.1.66045 WP_000404940.1.66046 WP_000404940.1.66053 WP_000404940.1.66087 WP_000404940.1.66099 WP_000404940.1.66115 WP_000404940.1.66132 WP_000404940.1.66135 WP_000404940.1.66139 WP_000404940.1.66146 WP_000404940.1.66164 WP_000404940.1.66166 WP_000404940.1.66191 WP_000404940.1.66195 WP_000404940.1.66205 WP_000404940.1.66207 WP_000404940.1.6621 WP_000404940.1.66230 WP_000404940.1.6625 WP_000404940.1.66274 WP_000404940.1.663 WP_000404940.1.66307 WP_000404940.1.66309 WP_000404940.1.66310 WP_000404940.1.66381 WP_000404940.1.66411 WP_000404940.1.66468 WP_000404940.1.66470 WP_000404940.1.66477 WP_000404940.1.66497 WP_000404940.1.66500 WP_000404940.1.66571 WP_000404940.1.66586 WP_000404940.1.66595 WP_000404940.1.66620 WP_000404940.1.66637 WP_000404940.1.66640 WP_000404940.1.66683 WP_000404940.1.66685 WP_000404940.1.66687 WP_000404940.1.66688 WP_000404940.1.66694 WP_000404940.1.66745 WP_000404940.1.66757 WP_000404940.1.6679 WP_000404940.1.66797 WP_000404940.1.66829 WP_000404940.1.66835 WP_000404940.1.66852 WP_000404940.1.66861 WP_000404940.1.66881 WP_000404940.1.669 WP_000404940.1.66914 WP_000404940.1.66917 WP_000404940.1.6694 WP_000404940.1.66956 WP_000404940.1.66966 WP_000404940.1.66971 WP_000404940.1.66973 WP_000404940.1.66983 WP_000404940.1.66995 WP_000404940.1.67039 WP_000404940.1.67051 WP_000404940.1.67076 WP_000404940.1.67080 WP_000404940.1.67084 WP_000404940.1.67114 WP_000404940.1.67121 WP_000404940.1.67148 WP_000404940.1.67151 WP_000404940.1.67169 WP_000404940.1.67196 WP_000404940.1.67215 WP_000404940.1.67222 WP_000404940.1.67274 WP_000404940.1.67304 WP_000404940.1.67327 WP_000404940.1.67353 WP_000404940.1.67358 WP_000404940.1.67389 WP_000404940.1.67398 WP_000404940.1.67416 WP_000404940.1.67443 WP_000404940.1.67458 WP_000404940.1.67469 WP_000404940.1.67494 WP_000404940.1.67498 WP_000404940.1.67508 WP_000404940.1.67510 WP_000404940.1.67515 WP_000404940.1.67565 WP_000404940.1.67583 WP_000404940.1.6759 WP_000404940.1.67596 WP_000404940.1.67613 WP_000404940.1.67639 WP_000404940.1.67655 WP_000404940.1.67684 WP_000404940.1.67697 WP_000404940.1.6773 WP_000404940.1.67739 WP_000404940.1.67748 WP_000404940.1.6776 WP_000404940.1.67761 WP_000404940.1.67773 WP_000404940.1.67793 WP_000404940.1.67797 WP_000404940.1.67804 WP_000404940.1.67807 WP_000404940.1.67831 WP_000404940.1.67840 WP_000404940.1.67881 WP_000404940.1.67885 WP_000404940.1.67921 WP_000404940.1.67930 WP_000404940.1.6795 WP_000404940.1.67950 WP_000404940.1.67965 WP_000404940.1.67967 WP_000404940.1.67994 WP_000404940.1.68002 WP_000404940.1.68017 WP_000404940.1.68072 WP_000404940.1.68077 WP_000404940.1.68078 WP_000404940.1.68084 WP_000404940.1.68103 WP_000404940.1.68192 WP_000404940.1.68220 WP_000404940.1.68238 WP_000404940.1.6826 WP_000404940.1.68267 WP_000404940.1.68287 WP_000404940.1.68306 WP_000404940.1.68310 WP_000404940.1.68352 WP_000404940.1.68363 WP_000404940.1.68377 WP_000404940.1.68381 WP_000404940.1.68406 WP_000404940.1.68427 WP_000404940.1.68430 WP_000404940.1.68431 WP_000404940.1.68453 WP_000404940.1.68458 WP_000404940.1.68460 WP_000404940.1.68469 WP_000404940.1.68494 WP_000404940.1.68503 WP_000404940.1.68508 WP_000404940.1.68535 WP_000404940.1.68557 WP_000404940.1.68560 WP_000404940.1.68567 WP_000404940.1.68578 WP_000404940.1.68596 WP_000404940.1.68597 WP_000404940.1.68600 WP_000404940.1.68622 WP_000404940.1.68653 WP_000404940.1.68660 WP_000404940.1.68661 WP_000404940.1.68671 WP_000404940.1.68682 WP_000404940.1.68686 WP_000404940.1.68689 WP_000404940.1.68712 WP_000404940.1.68721 WP_000404940.1.68729 WP_000404940.1.68755 WP_000404940.1.68777 WP_000404940.1.68784 WP_000404940.1.68807 WP_000404940.1.68812 WP_000404940.1.68814 WP_000404940.1.68819 WP_000404940.1.68822 WP_000404940.1.68825 WP_000404940.1.68835 WP_000404940.1.68851 WP_000404940.1.68852 WP_000404940.1.68853 WP_000404940.1.68872 WP_000404940.1.6894 WP_000404940.1.68963 WP_000404940.1.68992 WP_000404940.1.69005 WP_000404940.1.69037 WP_000404940.1.69052 WP_000404940.1.69063 WP_000404940.1.69065 WP_000404940.1.69104 WP_000404940.1.69116 WP_000404940.1.69137 WP_000404940.1.69148 WP_000404940.1.69149 WP_000404940.1.69211 WP_000404940.1.69215 WP_000404940.1.69224 WP_000404940.1.69230 WP_000404940.1.69234 WP_000404940.1.69235 WP_000404940.1.69241 WP_000404940.1.69246 WP_000404940.1.6925 WP_000404940.1.69313 WP_000404940.1.69321 WP_000404940.1.69344 WP_000404940.1.69399 WP_000404940.1.69416 WP_000404940.1.69431 WP_000404940.1.6948 WP_000404940.1.69482 WP_000404940.1.69486 WP_000404940.1.69493 WP_000404940.1.69499 WP_000404940.1.69500 WP_000404940.1.69512 WP_000404940.1.69531 WP_000404940.1.69538 WP_000404940.1.69541 WP_000404940.1.69543 WP_000404940.1.69549 WP_000404940.1.69560 WP_000404940.1.6961 WP_000404940.1.69623 WP_000404940.1.69626 WP_000404940.1.69641 WP_000404940.1.69671 WP_000404940.1.6969 WP_000404940.1.69695 WP_000404940.1.6970 WP_000404940.1.69715 WP_000404940.1.69731 WP_000404940.1.69739 WP_000404940.1.69752 WP_000404940.1.69757 WP_000404940.1.69797 WP_000404940.1.69798 WP_000404940.1.69825 WP_000404940.1.69850 WP_000404940.1.69863 WP_000404940.1.69866 WP_000404940.1.69869 WP_000404940.1.6988 WP_000404940.1.69905 WP_000404940.1.69911 WP_000404940.1.69940 WP_000404940.1.69954 WP_000404940.1.69962 WP_000404940.1.69998 WP_000404940.1.7 WP_000404940.1.70011 WP_000404940.1.70020 WP_000404940.1.70046 WP_000404940.1.70051 WP_000404940.1.70056 WP_000404940.1.70057 WP_000404940.1.70060 WP_000404940.1.70064 WP_000404940.1.70073 WP_000404940.1.70075 WP_000404940.1.7008 WP_000404940.1.70110 WP_000404940.1.70121 WP_000404940.1.70142 WP_000404940.1.70150 WP_000404940.1.70156 WP_000404940.1.70159 WP_000404940.1.70166 WP_000404940.1.7018 WP_000404940.1.70192 WP_000404940.1.70199 WP_000404940.1.70214 WP_000404940.1.70221 WP_000404940.1.70224 WP_000404940.1.70233 WP_000404940.1.70267 WP_000404940.1.70275 WP_000404940.1.70277 WP_000404940.1.70279 WP_000404940.1.70298 WP_000404940.1.70307 WP_000404940.1.70308 WP_000404940.1.70315 WP_000404940.1.70316 WP_000404940.1.70329 WP_000404940.1.7040 WP_000404940.1.70400 WP_000404940.1.70409 WP_000404940.1.70430 WP_000404940.1.70436 WP_000404940.1.7047 WP_000404940.1.70508 WP_000404940.1.70515 WP_000404940.1.70520 WP_000404940.1.70524 WP_000404940.1.70528 WP_000404940.1.70535 WP_000404940.1.70536 WP_000404940.1.70538 WP_000404940.1.70557 WP_000404940.1.70567 WP_000404940.1.7057 WP_000404940.1.70574 WP_000404940.1.7059 WP_000404940.1.70620 WP_000404940.1.70629 WP_000404940.1.70630 WP_000404940.1.70707 WP_000404940.1.70741 WP_000404940.1.7075 WP_000404940.1.7076 WP_000404940.1.70766 WP_000404940.1.70802 WP_000404940.1.70828 WP_000404940.1.70838 WP_000404940.1.70851 WP_000404940.1.70867 WP_000404940.1.70877 WP_000404940.1.70887 WP_000404940.1.70904 WP_000404940.1.70916 WP_000404940.1.70942 WP_000404940.1.70949 WP_000404940.1.70987 WP_000404940.1.70988 WP_000404940.1.71014 WP_000404940.1.71020 WP_000404940.1.71030 WP_000404940.1.71051 WP_000404940.1.71053 WP_000404940.1.71060 WP_000404940.1.71065 WP_000404940.1.71082 WP_000404940.1.71084 WP_000404940.1.71093 WP_000404940.1.7112 WP_000404940.1.71133 WP_000404940.1.71177 WP_000404940.1.71178 WP_000404940.1.71195 WP_000404940.1.71206 WP_000404940.1.71211 WP_000404940.1.7123 WP_000404940.1.7126 WP_000404940.1.71270 WP_000404940.1.71283 WP_000404940.1.71360 WP_000404940.1.71369 WP_000404940.1.71415 WP_000404940.1.71436 WP_000404940.1.71551 WP_000404940.1.71565 WP_000404940.1.71574 WP_000404940.1.71605 WP_000404940.1.71622 WP_000404940.1.71663 WP_000404940.1.71675 WP_000404940.1.71685 WP_000404940.1.71697 WP_000404940.1.71700 WP_000404940.1.7173 WP_000404940.1.71742 WP_000404940.1.71758 WP_000404940.1.71773 WP_000404940.1.71785 WP_000404940.1.71808 WP_000404940.1.71818 WP_000404940.1.71841 WP_000404940.1.71869 WP_000404940.1.71870 WP_000404940.1.71879 WP_000404940.1.71880 WP_000404940.1.71883 WP_000404940.1.71905 WP_000404940.1.71926 WP_000404940.1.71955 WP_000404940.1.71959 WP_000404940.1.71977 WP_000404940.1.72009 WP_000404940.1.72043 WP_000404940.1.72071 WP_000404940.1.72074 WP_000404940.1.72082 WP_000404940.1.72088 WP_000404940.1.72096 WP_000404940.1.72108 WP_000404940.1.72115 WP_000404940.1.72135 WP_000404940.1.72145 WP_000404940.1.72163 WP_000404940.1.72192 WP_000404940.1.72233 WP_000404940.1.72235 WP_000404940.1.72242 WP_000404940.1.72251 WP_000404940.1.72253 WP_000404940.1.72309 WP_000404940.1.72329 WP_000404940.1.72407 WP_000404940.1.72416 WP_000404940.1.72421 WP_000404940.1.72426 WP_000404940.1.72454 WP_000404940.1.7247 WP_000404940.1.72472 WP_000404940.1.72474 WP_000404940.1.72534 WP_000404940.1.72542 WP_000404940.1.72561 WP_000404940.1.72565 WP_000404940.1.72595 WP_000404940.1.72610 WP_000404940.1.7262 WP_000404940.1.72628 WP_000404940.1.72630 WP_000404940.1.72646 WP_000404940.1.7268 WP_000404940.1.727 WP_000404940.1.72705 WP_000404940.1.72712 WP_000404940.1.72736 WP_000404940.1.72769 WP_000404940.1.72781 WP_000404940.1.72785 WP_000404940.1.7279 WP_000404940.1.72796 WP_000404940.1.72825 WP_000404940.1.72854 WP_000404940.1.72855 WP_000404940.1.7289 WP_000404940.1.72890 WP_000404940.1.72900 WP_000404940.1.72911 WP_000404940.1.72922 WP_000404940.1.72926 WP_000404940.1.72932 WP_000404940.1.72934 WP_000404940.1.72940 WP_000404940.1.72942 WP_000404940.1.72963 WP_000404940.1.72978 WP_000404940.1.7299 WP_000404940.1.7300 WP_000404940.1.73012 WP_000404940.1.73043 WP_000404940.1.73051 WP_000404940.1.73058 WP_000404940.1.73064 WP_000404940.1.73065 WP_000404940.1.73071 WP_000404940.1.73089 WP_000404940.1.73093 WP_000404940.1.7310 WP_000404940.1.73101 WP_000404940.1.73106 WP_000404940.1.73133 WP_000404940.1.73178 WP_000404940.1.73181 WP_000404940.1.73185 WP_000404940.1.732 WP_000404940.1.73209 WP_000404940.1.73214 WP_000404940.1.73226 WP_000404940.1.73227 WP_000404940.1.73320 WP_000404940.1.73322 WP_000404940.1.73324 WP_000404940.1.73336 WP_000404940.1.73357 WP_000404940.1.73359 WP_000404940.1.73369 WP_000404940.1.73384 WP_000404940.1.73397 WP_000404940.1.73419 WP_000404940.1.73433 WP_000404940.1.73462 WP_000404940.1.7347 WP_000404940.1.73476 WP_000404940.1.73500 WP_000404940.1.73502 WP_000404940.1.73509 WP_000404940.1.7352 WP_000404940.1.73520 WP_000404940.1.73522 WP_000404940.1.73543 WP_000404940.1.73548 WP_000404940.1.73554 WP_000404940.1.73567 WP_000404940.1.73568 WP_000404940.1.7357 WP_000404940.1.73578 WP_000404940.1.73588 WP_000404940.1.73593 WP_000404940.1.73622 WP_000404940.1.73666 WP_000404940.1.73675 WP_000404940.1.73710 WP_000404940.1.73716 WP_000404940.1.73726 WP_000404940.1.73747 WP_000404940.1.73771 WP_000404940.1.73777 WP_000404940.1.73796 WP_000404940.1.73800 WP_000404940.1.73825 WP_000404940.1.73838 WP_000404940.1.73851 WP_000404940.1.73857 WP_000404940.1.73890 WP_000404940.1.73903 WP_000404940.1.73907 WP_000404940.1.73912 WP_000404940.1.73913 WP_000404940.1.73914 WP_000404940.1.73923 WP_000404940.1.73939 WP_000404940.1.73982 WP_000404940.1.74009 WP_000404940.1.74014 WP_000404940.1.74033 WP_000404940.1.74069 WP_000404940.1.74084 WP_000404940.1.7409 WP_000404940.1.74105 WP_000404940.1.74127 WP_000404940.1.74128 WP_000404940.1.74139 WP_000404940.1.7415 WP_000404940.1.7416 WP_000404940.1.74206 WP_000404940.1.74208 WP_000404940.1.74220 WP_000404940.1.74231 WP_000404940.1.74293 WP_000404940.1.74308 WP_000404940.1.7431 WP_000404940.1.74314 WP_000404940.1.74330 WP_000404940.1.74331 WP_000404940.1.74341 WP_000404940.1.74385 WP_000404940.1.74387 WP_000404940.1.74396 WP_000404940.1.74399 WP_000404940.1.74419 WP_000404940.1.74437 WP_000404940.1.74471 WP_000404940.1.7449 WP_000404940.1.74496 WP_000404940.1.74508 WP_000404940.1.74537 WP_000404940.1.74548 WP_000404940.1.74582 WP_000404940.1.74607 WP_000404940.1.74608 WP_000404940.1.74618 WP_000404940.1.74633 WP_000404940.1.7466 WP_000404940.1.74679 WP_000404940.1.7468 WP_000404940.1.74751 WP_000404940.1.74762 WP_000404940.1.74780 WP_000404940.1.74795 WP_000404940.1.74796 WP_000404940.1.74822 WP_000404940.1.74848 WP_000404940.1.7485 WP_000404940.1.74855 WP_000404940.1.74877 WP_000404940.1.7488 WP_000404940.1.74891 WP_000404940.1.74906 WP_000404940.1.74928 WP_000404940.1.7497 WP_000404940.1.74974 WP_000404940.1.7503 WP_000404940.1.75031 WP_000404940.1.75049 WP_000404940.1.7505 WP_000404940.1.75053 WP_000404940.1.75062 WP_000404940.1.75074 WP_000404940.1.75085 WP_000404940.1.75088 WP_000404940.1.75096 WP_000404940.1.75099 WP_000404940.1.75102 WP_000404940.1.75123 WP_000404940.1.75130 WP_000404940.1.75142 WP_000404940.1.75165 WP_000404940.1.7517 WP_000404940.1.75191 WP_000404940.1.75203 WP_000404940.1.75259 WP_000404940.1.75260 WP_000404940.1.7527 WP_000404940.1.75284 WP_000404940.1.75302 WP_000404940.1.75312 WP_000404940.1.75325 WP_000404940.1.75336 WP_000404940.1.75354 WP_000404940.1.75355 WP_000404940.1.75370 WP_000404940.1.75401 WP_000404940.1.75427 WP_000404940.1.75429 WP_000404940.1.75455 WP_000404940.1.75464 WP_000404940.1.75469 WP_000404940.1.7548 WP_000404940.1.75490 WP_000404940.1.75492 WP_000404940.1.75493 WP_000404940.1.75500 WP_000404940.1.75511 WP_000404940.1.75522 WP_000404940.1.7554 WP_000404940.1.75546 WP_000404940.1.75547 WP_000404940.1.75582 WP_000404940.1.75584 WP_000404940.1.75601 WP_000404940.1.75632 WP_000404940.1.75648 WP_000404940.1.75654 WP_000404940.1.75675 WP_000404940.1.75691 WP_000404940.1.75709 WP_000404940.1.75729 WP_000404940.1.75752 WP_000404940.1.75755 WP_000404940.1.75759 WP_000404940.1.75787 WP_000404940.1.75817 WP_000404940.1.75834 WP_000404940.1.75845 WP_000404940.1.75877 WP_000404940.1.75880 WP_000404940.1.75897 WP_000404940.1.75899 WP_000404940.1.75904 WP_000404940.1.75907 WP_000404940.1.7591 WP_000404940.1.75955 WP_000404940.1.75976 WP_000404940.1.75982 WP_000404940.1.75996 WP_000404940.1.760 WP_000404940.1.76003 WP_000404940.1.76017 WP_000404940.1.76051 WP_000404940.1.76067 WP_000404940.1.76068 WP_000404940.1.76080 WP_000404940.1.76091 WP_000404940.1.76093 WP_000404940.1.76161 WP_000404940.1.76166 WP_000404940.1.76195 WP_000404940.1.76202 WP_000404940.1.76220 WP_000404940.1.76233 WP_000404940.1.76249 WP_000404940.1.76251 WP_000404940.1.76263 WP_000404940.1.76264 WP_000404940.1.76265 WP_000404940.1.76285 WP_000404940.1.76289 WP_000404940.1.76344 WP_000404940.1.76357 WP_000404940.1.76375 WP_000404940.1.76393 WP_000404940.1.76409 WP_000404940.1.76440 WP_000404940.1.76453 WP_000404940.1.76454 WP_000404940.1.76458 WP_000404940.1.76492 WP_000404940.1.76499 WP_000404940.1.76517 WP_000404940.1.76557 WP_000404940.1.76564 WP_000404940.1.76567 WP_000404940.1.76570 WP_000404940.1.76577 WP_000404940.1.76591 WP_000404940.1.76594 WP_000404940.1.76614 WP_000404940.1.76631 WP_000404940.1.76649 WP_000404940.1.76667 WP_000404940.1.76720 WP_000404940.1.76722 WP_000404940.1.7673 WP_000404940.1.76731 WP_000404940.1.76761 WP_000404940.1.76764 WP_000404940.1.76777 WP_000404940.1.76780 WP_000404940.1.7679 WP_000404940.1.76830 WP_000404940.1.76850 WP_000404940.1.76857 WP_000404940.1.76865 WP_000404940.1.76868 WP_000404940.1.76892 WP_000404940.1.76927 WP_000404940.1.76972 WP_000404940.1.76980 WP_000404940.1.77 WP_000404940.1.77037 WP_000404940.1.77044 WP_000404940.1.77052 WP_000404940.1.7706 WP_000404940.1.77088 WP_000404940.1.77094 WP_000404940.1.77103 WP_000404940.1.77104 WP_000404940.1.77121 WP_000404940.1.7714 WP_000404940.1.77156 WP_000404940.1.77167 WP_000404940.1.77172 WP_000404940.1.77195 WP_000404940.1.77197 WP_000404940.1.77223 WP_000404940.1.77243 WP_000404940.1.7725 WP_000404940.1.77269 WP_000404940.1.77278 WP_000404940.1.77318 WP_000404940.1.7735 WP_000404940.1.77353 WP_000404940.1.77375 WP_000404940.1.77379 WP_000404940.1.77399 WP_000404940.1.7741 WP_000404940.1.77413 WP_000404940.1.77434 WP_000404940.1.77439 WP_000404940.1.77456 WP_000404940.1.77480 WP_000404940.1.77505 WP_000404940.1.7751 WP_000404940.1.77535 WP_000404940.1.77552 WP_000404940.1.77568 WP_000404940.1.77582 WP_000404940.1.77585 WP_000404940.1.7761 WP_000404940.1.77610 WP_000404940.1.77637 WP_000404940.1.77659 WP_000404940.1.77663 WP_000404940.1.77664 WP_000404940.1.77670 WP_000404940.1.77731 WP_000404940.1.77747 WP_000404940.1.77755 WP_000404940.1.77765 WP_000404940.1.77770 WP_000404940.1.77785 WP_000404940.1.77789 WP_000404940.1.77808 WP_000404940.1.77847 WP_000404940.1.77870 WP_000404940.1.77877 WP_000404940.1.77894 WP_000404940.1.77906 WP_000404940.1.77912 WP_000404940.1.77939 WP_000404940.1.77944 WP_000404940.1.77947 WP_000404940.1.77976 WP_000404940.1.77982 WP_000404940.1.78025 WP_000404940.1.7803 WP_000404940.1.78030 WP_000404940.1.78045 WP_000404940.1.78058 WP_000404940.1.78068 WP_000404940.1.78087 WP_000404940.1.7812 WP_000404940.1.78129 WP_000404940.1.78139 WP_000404940.1.78147 WP_000404940.1.78191 WP_000404940.1.7822 WP_000404940.1.78241 WP_000404940.1.78275 WP_000404940.1.7828 WP_000404940.1.78298 WP_000404940.1.78312 WP_000404940.1.78343 WP_000404940.1.78349 WP_000404940.1.78379 WP_000404940.1.7838 WP_000404940.1.78389 WP_000404940.1.78397 WP_000404940.1.78422 WP_000404940.1.78444 WP_000404940.1.78454 WP_000404940.1.78455 WP_000404940.1.78457 WP_000404940.1.7846 WP_000404940.1.78465 WP_000404940.1.78475 WP_000404940.1.78535 WP_000404940.1.78541 WP_000404940.1.78563 WP_000404940.1.78569 WP_000404940.1.78588 WP_000404940.1.78609 WP_000404940.1.78629 WP_000404940.1.78690 WP_000404940.1.78720 WP_000404940.1.78724 WP_000404940.1.78755 WP_000404940.1.78762 WP_000404940.1.78796 WP_000404940.1.78828 WP_000404940.1.78832 WP_000404940.1.78866 WP_000404940.1.78876 WP_000404940.1.78887 WP_000404940.1.78889 WP_000404940.1.78890 WP_000404940.1.78939 WP_000404940.1.78965 WP_000404940.1.78967 WP_000404940.1.78979 WP_000404940.1.79008 WP_000404940.1.79040 WP_000404940.1.79073 WP_000404940.1.79079 WP_000404940.1.79080 WP_000404940.1.79096 WP_000404940.1.7910 WP_000404940.1.79104 WP_000404940.1.79124 WP_000404940.1.79134 WP_000404940.1.79138 WP_000404940.1.7915 WP_000404940.1.79169 WP_000404940.1.79173 WP_000404940.1.7919 WP_000404940.1.7920 WP_000404940.1.79202 WP_000404940.1.79228 WP_000404940.1.7924 WP_000404940.1.79298 WP_000404940.1.79329 WP_000404940.1.79349 WP_000404940.1.7941 WP_000404940.1.79410 WP_000404940.1.79418 WP_000404940.1.79451 WP_000404940.1.79469 WP_000404940.1.79496 WP_000404940.1.7950 WP_000404940.1.7954 WP_000404940.1.79546 WP_000404940.1.79555 WP_000404940.1.7959 WP_000404940.1.79594 WP_000404940.1.79612 WP_000404940.1.79616 WP_000404940.1.79669 WP_000404940.1.79671 WP_000404940.1.79675 WP_000404940.1.7968 WP_000404940.1.79688 WP_000404940.1.79690 WP_000404940.1.79693 WP_000404940.1.79705 WP_000404940.1.79732 WP_000404940.1.79746 WP_000404940.1.79748 WP_000404940.1.79761 WP_000404940.1.79767 WP_000404940.1.79786 WP_000404940.1.79793 WP_000404940.1.798 WP_000404940.1.79809 WP_000404940.1.79811 WP_000404940.1.79830 WP_000404940.1.79835 WP_000404940.1.79841 WP_000404940.1.79899 WP_000404940.1.79920 WP_000404940.1.79927 WP_000404940.1.79958 WP_000404940.1.79969 WP_000404940.1.7998 WP_000404940.1.800 WP_000404940.1.80019 WP_000404940.1.8003 WP_000404940.1.80049 WP_000404940.1.80070 WP_000404940.1.80074 WP_000404940.1.80130 WP_000404940.1.80161 WP_000404940.1.80190 WP_000404940.1.80191 WP_000404940.1.80196 WP_000404940.1.80200 WP_000404940.1.80211 WP_000404940.1.80228 WP_000404940.1.80231 WP_000404940.1.80248 WP_000404940.1.80251 WP_000404940.1.80256 WP_000404940.1.80261 WP_000404940.1.80268 WP_000404940.1.80294 WP_000404940.1.80321 WP_000404940.1.80328 WP_000404940.1.80349 WP_000404940.1.80364 WP_000404940.1.80372 WP_000404940.1.80373 WP_000404940.1.80376 WP_000404940.1.8041 WP_000404940.1.80427 WP_000404940.1.80435 WP_000404940.1.80449 WP_000404940.1.80457 WP_000404940.1.8048 WP_000404940.1.80495 WP_000404940.1.80516 WP_000404940.1.80532 WP_000404940.1.80539 WP_000404940.1.80548 WP_000404940.1.80550 WP_000404940.1.80597 WP_000404940.1.80611 WP_000404940.1.80613 WP_000404940.1.80619 WP_000404940.1.80672 WP_000404940.1.80689 WP_000404940.1.80691 WP_000404940.1.80748 WP_000404940.1.80758 WP_000404940.1.80765 WP_000404940.1.80774 WP_000404940.1.80775 WP_000404940.1.80856 WP_000404940.1.80875 WP_000404940.1.80914 WP_000404940.1.80919 WP_000404940.1.80934 WP_000404940.1.80944 WP_000404940.1.80949 WP_000404940.1.80971 WP_000404940.1.80990 WP_000404940.1.80996 WP_000404940.1.8101 WP_000404940.1.81033 WP_000404940.1.81048 WP_000404940.1.8109 WP_000404940.1.81090 WP_000404940.1.81134 WP_000404940.1.81170 WP_000404940.1.81173 WP_000404940.1.81179 WP_000404940.1.81183 WP_000404940.1.81190 WP_000404940.1.81201 WP_000404940.1.81236 WP_000404940.1.81241 WP_000404940.1.81292 WP_000404940.1.81296 WP_000404940.1.81309 WP_000404940.1.81314 WP_000404940.1.81343 WP_000404940.1.8136 WP_000404940.1.81360 WP_000404940.1.81367 WP_000404940.1.81369 WP_000404940.1.81375 WP_000404940.1.81381 WP_000404940.1.81390 WP_000404940.1.81398 WP_000404940.1.81408 WP_000404940.1.81473 WP_000404940.1.81481 WP_000404940.1.81483 WP_000404940.1.81493 WP_000404940.1.815 WP_000404940.1.81500 WP_000404940.1.81533 WP_000404940.1.81534 WP_000404940.1.8154 WP_000404940.1.81545 WP_000404940.1.81550 WP_000404940.1.81573 WP_000404940.1.81585 WP_000404940.1.81586 WP_000404940.1.81587 WP_000404940.1.81628 WP_000404940.1.81630 WP_000404940.1.81639 WP_000404940.1.81663 WP_000404940.1.81694 WP_000404940.1.81716 WP_000404940.1.81724 WP_000404940.1.81733 WP_000404940.1.81775 WP_000404940.1.81781 WP_000404940.1.818 WP_000404940.1.81801 WP_000404940.1.81807 WP_000404940.1.81817 WP_000404940.1.81890 WP_000404940.1.81894 WP_000404940.1.81929 WP_000404940.1.81962 WP_000404940.1.81967 WP_000404940.1.81984 WP_000404940.1.82016 WP_000404940.1.82020 WP_000404940.1.82029 WP_000404940.1.82033 WP_000404940.1.82042 WP_000404940.1.82049 WP_000404940.1.82051 WP_000404940.1.82052 WP_000404940.1.82085 WP_000404940.1.82094 WP_000404940.1.82140 WP_000404940.1.82159 WP_000404940.1.82181 WP_000404940.1.82189 WP_000404940.1.82191 WP_000404940.1.82195 WP_000404940.1.8221 WP_000404940.1.82212 WP_000404940.1.82229 WP_000404940.1.82255 WP_000404940.1.82279 WP_000404940.1.82284 WP_000404940.1.82297 WP_000404940.1.823 WP_000404940.1.82302 WP_000404940.1.82306 WP_000404940.1.82338 WP_000404940.1.82342 WP_000404940.1.82345 WP_000404940.1.82392 WP_000404940.1.82407 WP_000404940.1.82423 WP_000404940.1.82437 WP_000404940.1.82459 WP_000404940.1.82463 WP_000404940.1.8248 WP_000404940.1.82481 WP_000404940.1.82502 WP_000404940.1.82505 WP_000404940.1.82518 WP_000404940.1.82528 WP_000404940.1.82537 WP_000404940.1.82552 WP_000404940.1.82557 WP_000404940.1.82563 WP_000404940.1.82564 WP_000404940.1.8257 WP_000404940.1.82600 WP_000404940.1.82603 WP_000404940.1.82650 WP_000404940.1.82652 WP_000404940.1.82660 WP_000404940.1.82666 WP_000404940.1.82680 WP_000404940.1.82693 WP_000404940.1.82699 WP_000404940.1.82732 WP_000404940.1.82733 WP_000404940.1.82737 WP_000404940.1.8275 WP_000404940.1.82750 WP_000404940.1.82758 WP_000404940.1.8276 WP_000404940.1.82771 WP_000404940.1.82777 WP_000404940.1.82783 WP_000404940.1.82792 WP_000404940.1.82793 WP_000404940.1.82818 WP_000404940.1.82827 WP_000404940.1.8283 WP_000404940.1.82839 WP_000404940.1.82845 WP_000404940.1.82847 WP_000404940.1.82869 WP_000404940.1.82877 WP_000404940.1.82885 WP_000404940.1.82900 WP_000404940.1.82911 WP_000404940.1.82921 WP_000404940.1.82929 WP_000404940.1.8293 WP_000404940.1.82958 WP_000404940.1.82969 WP_000404940.1.82970 WP_000404940.1.82985 WP_000404940.1.82994 WP_000404940.1.83042 WP_000404940.1.83055 WP_000404940.1.83067 WP_000404940.1.83094 WP_000404940.1.83107 WP_000404940.1.83111 WP_000404940.1.83115 WP_000404940.1.83123 WP_000404940.1.83135 WP_000404940.1.83136 WP_000404940.1.8315 WP_000404940.1.83158 WP_000404940.1.8316 WP_000404940.1.83164 WP_000404940.1.83168 WP_000404940.1.83169 WP_000404940.1.83174 WP_000404940.1.83183 WP_000404940.1.83189 WP_000404940.1.83227 WP_000404940.1.83231 WP_000404940.1.83239 WP_000404940.1.83242 WP_000404940.1.83244 WP_000404940.1.83278 WP_000404940.1.83281 WP_000404940.1.83306 WP_000404940.1.8331 WP_000404940.1.83311 WP_000404940.1.83319 WP_000404940.1.83324 WP_000404940.1.83335 WP_000404940.1.83371 WP_000404940.1.83403 WP_000404940.1.83432 WP_000404940.1.83446 WP_000404940.1.83455 WP_000404940.1.83456 WP_000404940.1.83457 WP_000404940.1.8347 WP_000404940.1.83485 WP_000404940.1.83489 WP_000404940.1.83518 WP_000404940.1.8352 WP_000404940.1.83565 WP_000404940.1.83577 WP_000404940.1.83578 WP_000404940.1.83585 WP_000404940.1.83586 WP_000404940.1.83587 WP_000404940.1.8360 WP_000404940.1.83604 WP_000404940.1.83606 WP_000404940.1.83613 WP_000404940.1.83635 WP_000404940.1.83681 WP_000404940.1.83713 WP_000404940.1.83719 WP_000404940.1.83726 WP_000404940.1.83730 WP_000404940.1.83731 WP_000404940.1.83752 WP_000404940.1.83776 WP_000404940.1.83789 WP_000404940.1.83790 WP_000404940.1.83796 WP_000404940.1.83840 WP_000404940.1.83863 WP_000404940.1.83866 WP_000404940.1.83888 WP_000404940.1.83898 WP_000404940.1.83899 WP_000404940.1.83910 WP_000404940.1.83934 WP_000404940.1.83956 WP_000404940.1.83961 WP_000404940.1.83974 WP_000404940.1.83978 WP_000404940.1.8398 WP_000404940.1.84013 WP_000404940.1.84017 WP_000404940.1.84038 WP_000404940.1.84044 WP_000404940.1.84052 WP_000404940.1.84056 WP_000404940.1.84061 WP_000404940.1.84062 WP_000404940.1.84065 WP_000404940.1.84080 WP_000404940.1.84095 WP_000404940.1.84111 WP_000404940.1.84113 WP_000404940.1.84116 WP_000404940.1.84125 WP_000404940.1.84147 WP_000404940.1.8416 WP_000404940.1.84182 WP_000404940.1.84211 WP_000404940.1.84213 WP_000404940.1.84214 WP_000404940.1.84220 WP_000404940.1.84225 WP_000404940.1.8423 WP_000404940.1.84237 WP_000404940.1.84258 WP_000404940.1.84292 WP_000404940.1.84305 WP_000404940.1.84353 WP_000404940.1.84363 WP_000404940.1.84444 WP_000404940.1.84477 WP_000404940.1.84505 WP_000404940.1.84513 WP_000404940.1.84521 WP_000404940.1.8454 WP_000404940.1.84542 WP_000404940.1.84576 WP_000404940.1.84633 WP_000404940.1.84640 WP_000404940.1.84643 WP_000404940.1.84664 WP_000404940.1.84672 WP_000404940.1.84747 WP_000404940.1.84785 WP_000404940.1.8481 WP_000404940.1.84821 WP_000404940.1.84827 WP_000404940.1.8483 WP_000404940.1.84842 WP_000404940.1.8486 WP_000404940.1.84897 WP_000404940.1.84910 WP_000404940.1.84955 WP_000404940.1.84979 WP_000404940.1.84991 WP_000404940.1.84998 WP_000404940.1.85019 WP_000404940.1.85021 WP_000404940.1.85033 WP_000404940.1.8506 WP_000404940.1.85061 WP_000404940.1.85062 WP_000404940.1.85064 WP_000404940.1.8507 WP_000404940.1.85093 WP_000404940.1.85095 WP_000404940.1.8510 WP_000404940.1.85103 WP_000404940.1.85111 WP_000404940.1.85171 WP_000404940.1.85195 WP_000404940.1.85212 WP_000404940.1.85215 WP_000404940.1.85222 WP_000404940.1.85232 WP_000404940.1.85233 WP_000404940.1.8524 WP_000404940.1.85250 WP_000404940.1.85258 WP_000404940.1.85286 WP_000404940.1.8534 WP_000404940.1.85379 WP_000404940.1.85392 WP_000404940.1.85393 WP_000404940.1.85400 WP_000404940.1.85418 WP_000404940.1.85427 WP_000404940.1.85452 WP_000404940.1.8547 WP_000404940.1.85470 WP_000404940.1.85494 WP_000404940.1.85496 WP_000404940.1.85508 WP_000404940.1.85509 WP_000404940.1.85526 WP_000404940.1.85552 WP_000404940.1.85581 WP_000404940.1.85588 WP_000404940.1.85608 WP_000404940.1.85609 WP_000404940.1.85612 WP_000404940.1.85613 WP_000404940.1.85625 WP_000404940.1.85629 WP_000404940.1.85652 WP_000404940.1.85659 WP_000404940.1.85661 WP_000404940.1.8569 WP_000404940.1.85697 WP_000404940.1.85745 WP_000404940.1.85748 WP_000404940.1.85750 WP_000404940.1.85760 WP_000404940.1.85789 WP_000404940.1.85826 WP_000404940.1.85849 WP_000404940.1.85880 WP_000404940.1.85881 WP_000404940.1.85882 WP_000404940.1.85896 WP_000404940.1.8590 WP_000404940.1.85907 WP_000404940.1.85918 WP_000404940.1.85921 WP_000404940.1.85942 WP_000404940.1.85947 WP_000404940.1.85962 WP_000404940.1.86020 WP_000404940.1.86040 WP_000404940.1.86061 WP_000404940.1.86075 WP_000404940.1.86118 WP_000404940.1.86130 WP_000404940.1.86237 WP_000404940.1.86238 WP_000404940.1.86254 WP_000404940.1.86282 WP_000404940.1.86296 WP_000404940.1.86297 WP_000404940.1.86309 WP_000404940.1.86312 WP_000404940.1.86320 WP_000404940.1.86326 WP_000404940.1.86360 WP_000404940.1.86403 WP_000404940.1.86407 WP_000404940.1.86423 WP_000404940.1.86440 WP_000404940.1.86457 WP_000404940.1.8646 WP_000404940.1.86496 WP_000404940.1.86503 WP_000404940.1.86507 WP_000404940.1.86529 WP_000404940.1.86539 WP_000404940.1.86546 WP_000404940.1.8655 WP_000404940.1.86558 WP_000404940.1.86559 WP_000404940.1.86612 WP_000404940.1.86614 WP_000404940.1.86631 WP_000404940.1.86632 WP_000404940.1.86636 WP_000404940.1.86655 WP_000404940.1.86659 WP_000404940.1.86685 WP_000404940.1.86689 WP_000404940.1.86721 WP_000404940.1.86722 WP_000404940.1.86723 WP_000404940.1.86724 WP_000404940.1.8674 WP_000404940.1.86742 WP_000404940.1.86746 WP_000404940.1.86747 WP_000404940.1.86750 WP_000404940.1.86751 WP_000404940.1.86772 WP_000404940.1.86798 WP_000404940.1.86812 WP_000404940.1.86875 WP_000404940.1.86880 WP_000404940.1.86887 WP_000404940.1.86913 WP_000404940.1.86918 WP_000404940.1.86939 WP_000404940.1.86996 WP_000404940.1.87065 WP_000404940.1.87069 WP_000404940.1.87073 WP_000404940.1.87077 WP_000404940.1.8708 WP_000404940.1.87118 WP_000404940.1.87135 WP_000404940.1.87138 WP_000404940.1.87160 WP_000404940.1.87186 WP_000404940.1.87200 WP_000404940.1.87229 WP_000404940.1.8724 WP_000404940.1.87248 WP_000404940.1.87289 WP_000404940.1.87297 WP_000404940.1.87317 WP_000404940.1.87331 WP_000404940.1.87336 WP_000404940.1.8734 WP_000404940.1.87347 WP_000404940.1.87352 WP_000404940.1.87375 WP_000404940.1.87421 WP_000404940.1.87422 WP_000404940.1.8744 WP_000404940.1.8747 WP_000404940.1.87510 WP_000404940.1.87521 WP_000404940.1.87592 WP_000404940.1.87604 WP_000404940.1.87621 WP_000404940.1.87664 WP_000404940.1.87681 WP_000404940.1.877 WP_000404940.1.87719 WP_000404940.1.87731 WP_000404940.1.87771 WP_000404940.1.87774 WP_000404940.1.87775 WP_000404940.1.87792 WP_000404940.1.87815 WP_000404940.1.87824 WP_000404940.1.87829 WP_000404940.1.87839 WP_000404940.1.87863 WP_000404940.1.87868 WP_000404940.1.87872 WP_000404940.1.87901 WP_000404940.1.87904 WP_000404940.1.87909 WP_000404940.1.87910 WP_000404940.1.87922 WP_000404940.1.87942 WP_000404940.1.87961 WP_000404940.1.87969 WP_000404940.1.87971 WP_000404940.1.8799 WP_000404940.1.87993 WP_000404940.1.87998 WP_000404940.1.88008 WP_000404940.1.88054 WP_000404940.1.88056 WP_000404940.1.88084 WP_000404940.1.88129 WP_000404940.1.88167 WP_000404940.1.88170 WP_000404940.1.88172 WP_000404940.1.88176 WP_000404940.1.8818 WP_000404940.1.88182 WP_000404940.1.88203 WP_000404940.1.88218 WP_000404940.1.88224 WP_000404940.1.88225 WP_000404940.1.88228 WP_000404940.1.8823 WP_000404940.1.88232 WP_000404940.1.88254 WP_000404940.1.88280 WP_000404940.1.883 WP_000404940.1.88343 WP_000404940.1.88391 WP_000404940.1.88428 WP_000404940.1.88433 WP_000404940.1.88488 WP_000404940.1.88509 WP_000404940.1.88519 WP_000404940.1.88523 WP_000404940.1.88544 WP_000404940.1.88586 WP_000404940.1.88602 WP_000404940.1.88652 WP_000404940.1.88662 WP_000404940.1.88669 WP_000404940.1.88693 WP_000404940.1.88697 WP_000404940.1.88699 WP_000404940.1.88700 WP_000404940.1.88719 WP_000404940.1.88722 WP_000404940.1.88724 WP_000404940.1.8876 WP_000404940.1.88811 WP_000404940.1.88825 WP_000404940.1.88840 WP_000404940.1.88841 WP_000404940.1.88848 WP_000404940.1.88862 WP_000404940.1.88869 WP_000404940.1.88904 WP_000404940.1.88939 WP_000404940.1.88940 WP_000404940.1.88984 WP_000404940.1.89016 WP_000404940.1.89032 WP_000404940.1.89034 WP_000404940.1.89057 WP_000404940.1.89059 WP_000404940.1.89094 WP_000404940.1.89134 WP_000404940.1.8914 WP_000404940.1.89190 WP_000404940.1.89208 WP_000404940.1.89224 WP_000404940.1.89253 WP_000404940.1.8926 WP_000404940.1.89282 WP_000404940.1.89294 WP_000404940.1.8930 WP_000404940.1.89346 WP_000404940.1.89369 WP_000404940.1.89370 WP_000404940.1.89375 WP_000404940.1.89444 WP_000404940.1.89489 WP_000404940.1.89493 WP_000404940.1.89498 WP_000404940.1.89504 WP_000404940.1.89525 WP_000404940.1.89532 WP_000404940.1.89539 WP_000404940.1.89563 WP_000404940.1.89565 WP_000404940.1.89620 WP_000404940.1.8963 WP_000404940.1.89640 WP_000404940.1.89645 WP_000404940.1.89649 WP_000404940.1.89652 WP_000404940.1.89654 WP_000404940.1.89681 WP_000404940.1.89702 WP_000404940.1.89708 WP_000404940.1.8973 WP_000404940.1.89757 WP_000404940.1.89763 WP_000404940.1.89793 WP_000404940.1.89806 WP_000404940.1.89828 WP_000404940.1.89837 WP_000404940.1.89843 WP_000404940.1.89850 WP_000404940.1.89858 WP_000404940.1.89875 WP_000404940.1.89887 WP_000404940.1.89891 WP_000404940.1.89905 WP_000404940.1.89907 WP_000404940.1.89930 WP_000404940.1.89967 WP_000404940.1.89982 WP_000404940.1.90010 WP_000404940.1.90053 WP_000404940.1.90059 WP_000404940.1.90062 WP_000404940.1.90071 WP_000404940.1.90113 WP_000404940.1.90119 WP_000404940.1.90124 WP_000404940.1.90143 WP_000404940.1.90158 WP_000404940.1.90163 WP_000404940.1.90166 WP_000404940.1.90178 WP_000404940.1.9018 WP_000404940.1.90186 WP_000404940.1.90192 WP_000404940.1.90197 WP_000404940.1.90202 WP_000404940.1.90213 WP_000404940.1.90234 WP_000404940.1.90261 WP_000404940.1.9027 WP_000404940.1.90281 WP_000404940.1.90304 WP_000404940.1.90312 WP_000404940.1.90313 WP_000404940.1.90319 WP_000404940.1.90339 WP_000404940.1.90356 WP_000404940.1.90361 WP_000404940.1.90385 WP_000404940.1.90396 WP_000404940.1.90410 WP_000404940.1.90425 WP_000404940.1.90443 WP_000404940.1.9045 WP_000404940.1.90463 WP_000404940.1.90482 WP_000404940.1.90486 WP_000404940.1.90495 WP_000404940.1.90501 WP_000404940.1.90502 WP_000404940.1.90535 WP_000404940.1.9057 WP_000404940.1.90572 WP_000404940.1.90577 WP_000404940.1.90597 WP_000404940.1.90603 WP_000404940.1.90606 WP_000404940.1.90615 WP_000404940.1.90618 WP_000404940.1.90628 WP_000404940.1.90663 WP_000404940.1.90678 WP_000404940.1.90693 WP_000404940.1.90695 WP_000404940.1.907 WP_000404940.1.90712 WP_000404940.1.90727 WP_000404940.1.90762 WP_000404940.1.90768 WP_000404940.1.90778 WP_000404940.1.90805 WP_000404940.1.90809 WP_000404940.1.90869 WP_000404940.1.90894 WP_000404940.1.9090 WP_000404940.1.90925 WP_000404940.1.90929 WP_000404940.1.90936 WP_000404940.1.90942 WP_000404940.1.90957 WP_000404940.1.90965 WP_000404940.1.90970 WP_000404940.1.91015 WP_000404940.1.91024 WP_000404940.1.91034 WP_000404940.1.91037 WP_000404940.1.91041 WP_000404940.1.91052 WP_000404940.1.91058 WP_000404940.1.91078 WP_000404940.1.91079 WP_000404940.1.9108 WP_000404940.1.91099 WP_000404940.1.91125 WP_000404940.1.91127 WP_000404940.1.91129 WP_000404940.1.91131 WP_000404940.1.91154 WP_000404940.1.91172 WP_000404940.1.91176 WP_000404940.1.91178 WP_000404940.1.91193 WP_000404940.1.91217 WP_000404940.1.9124 WP_000404940.1.91269 WP_000404940.1.91271 WP_000404940.1.91292 WP_000404940.1.91339 WP_000404940.1.91358 WP_000404940.1.91383 WP_000404940.1.91388 WP_000404940.1.91407 WP_000404940.1.91412 WP_000404940.1.91413 WP_000404940.1.91432 WP_000404940.1.9146 WP_000404940.1.91468 WP_000404940.1.91481 WP_000404940.1.91545 WP_000404940.1.91562 WP_000404940.1.9162 WP_000404940.1.91650 WP_000404940.1.91653 WP_000404940.1.91656 WP_000404940.1.91686 WP_000404940.1.91705 WP_000404940.1.91714 WP_000404940.1.91718 WP_000404940.1.91719 WP_000404940.1.9173 WP_000404940.1.91733 WP_000404940.1.91775 WP_000404940.1.91808 WP_000404940.1.91811 WP_000404940.1.91815 WP_000404940.1.91821 WP_000404940.1.91839 WP_000404940.1.9184 WP_000404940.1.91858 WP_000404940.1.91878 WP_000404940.1.91881 WP_000404940.1.91886 WP_000404940.1.91888 WP_000404940.1.91902 WP_000404940.1.9192 WP_000404940.1.91927 WP_000404940.1.91934 WP_000404940.1.91947 WP_000404940.1.91949 WP_000404940.1.91960 WP_000404940.1.91972 WP_000404940.1.91985 WP_000404940.1.92006 WP_000404940.1.92010 WP_000404940.1.92015 WP_000404940.1.92027 WP_000404940.1.92032 WP_000404940.1.92034 WP_000404940.1.92061 WP_000404940.1.92065 WP_000404940.1.9207 WP_000404940.1.92077 WP_000404940.1.92086 WP_000404940.1.92092 WP_000404940.1.92103 WP_000404940.1.92116 WP_000404940.1.92121 WP_000404940.1.92124 WP_000404940.1.92166 WP_000404940.1.92167 WP_000404940.1.92168 WP_000404940.1.92178 WP_000404940.1.9218 WP_000404940.1.92187 WP_000404940.1.92225 WP_000404940.1.92248 WP_000404940.1.92271 WP_000404940.1.92298 WP_000404940.1.92301 WP_000404940.1.92326 WP_000404940.1.92342 WP_000404940.1.92344 WP_000404940.1.92351 WP_000404940.1.92353 WP_000404940.1.92355 WP_000404940.1.92381 WP_000404940.1.92386 WP_000404940.1.92389 WP_000404940.1.92450 WP_000404940.1.92457 WP_000404940.1.92464 WP_000404940.1.92487 WP_000404940.1.92491 WP_000404940.1.92502 WP_000404940.1.92563 WP_000404940.1.9260 WP_000404940.1.92631 WP_000404940.1.92640 WP_000404940.1.92652 WP_000404940.1.92656 WP_000404940.1.92682 WP_000404940.1.92724 WP_000404940.1.92732 WP_000404940.1.9275 WP_000404940.1.92812 WP_000404940.1.92850 WP_000404940.1.92854 WP_000404940.1.92866 WP_000404940.1.92872 WP_000404940.1.92874 WP_000404940.1.92878 WP_000404940.1.92896 WP_000404940.1.92906 WP_000404940.1.92967 WP_000404940.1.92969 WP_000404940.1.9297 WP_000404940.1.92971 WP_000404940.1.9299 WP_000404940.1.93021 WP_000404940.1.93075 WP_000404940.1.93084 WP_000404940.1.93096 WP_000404940.1.93108 WP_000404940.1.93126 WP_000404940.1.93129 WP_000404940.1.93152 WP_000404940.1.93154 WP_000404940.1.93156 WP_000404940.1.93158 WP_000404940.1.93173 WP_000404940.1.93178 WP_000404940.1.93183 WP_000404940.1.93202 WP_000404940.1.93210 WP_000404940.1.93238 WP_000404940.1.93253 WP_000404940.1.9326 WP_000404940.1.93262 WP_000404940.1.93274 WP_000404940.1.93281 WP_000404940.1.93294 WP_000404940.1.93311 WP_000404940.1.93314 WP_000404940.1.9332 WP_000404940.1.93347 WP_000404940.1.93361 WP_000404940.1.9339 WP_000404940.1.93398 WP_000404940.1.93401 WP_000404940.1.93404 WP_000404940.1.93425 WP_000404940.1.9345 WP_000404940.1.93452 WP_000404940.1.93462 WP_000404940.1.9347 WP_000404940.1.93474 WP_000404940.1.93475 WP_000404940.1.9348 WP_000404940.1.93489 WP_000404940.1.935 WP_000404940.1.93515 WP_000404940.1.93525 WP_000404940.1.93548 WP_000404940.1.93592 WP_000404940.1.93595 WP_000404940.1.93606 WP_000404940.1.93609 WP_000404940.1.93636 WP_000404940.1.9364 WP_000404940.1.93641 WP_000404940.1.93680 WP_000404940.1.9369 WP_000404940.1.93696 WP_000404940.1.93700 WP_000404940.1.93701 WP_000404940.1.93703 WP_000404940.1.93720 WP_000404940.1.93773 WP_000404940.1.93785 WP_000404940.1.93811 WP_000404940.1.93814 WP_000404940.1.93832 WP_000404940.1.93865 WP_000404940.1.93869 WP_000404940.1.93878 WP_000404940.1.93906 WP_000404940.1.93910 WP_000404940.1.93915 WP_000404940.1.93947 WP_000404940.1.93974 WP_000404940.1.94024 WP_000404940.1.94029 WP_000404940.1.9403 WP_000404940.1.94061 WP_000404940.1.94090 WP_000404940.1.94092 WP_000404940.1.94098 WP_000404940.1.94101 WP_000404940.1.94104 WP_000404940.1.94105 WP_000404940.1.94139 WP_000404940.1.9414 WP_000404940.1.94145 WP_000404940.1.94148 WP_000404940.1.94157 WP_000404940.1.94159 WP_000404940.1.94170 WP_000404940.1.94192 WP_000404940.1.94195 WP_000404940.1.94220 WP_000404940.1.94247 WP_000404940.1.94258 WP_000404940.1.94263 WP_000404940.1.94269 WP_000404940.1.9429 WP_000404940.1.943 WP_000404940.1.94323 WP_000404940.1.94330 WP_000404940.1.94334 WP_000404940.1.94357 WP_000404940.1.94368 WP_000404940.1.94369 WP_000404940.1.94391 WP_000404940.1.94395 WP_000404940.1.94425 WP_000404940.1.94442 WP_000404940.1.94459 WP_000404940.1.94469 WP_000404940.1.94476 WP_000404940.1.945 WP_000404940.1.94503 WP_000404940.1.94509 WP_000404940.1.94515 WP_000404940.1.9452 WP_000404940.1.94526 WP_000404940.1.94539 WP_000404940.1.94558 WP_000404940.1.94559 WP_000404940.1.94577 WP_000404940.1.94595 WP_000404940.1.94604 WP_000404940.1.94610 WP_000404940.1.94643 WP_000404940.1.94644 WP_000404940.1.94651 WP_000404940.1.94652 WP_000404940.1.94689 WP_000404940.1.94711 WP_000404940.1.94724 WP_000404940.1.94771 WP_000404940.1.94778 WP_000404940.1.94810 WP_000404940.1.94811 WP_000404940.1.94876 WP_000404940.1.94883 WP_000404940.1.94885 WP_000404940.1.94954 WP_000404940.1.95041 WP_000404940.1.95050 WP_000404940.1.95058 WP_000404940.1.9508 WP_000404940.1.95098 WP_000404940.1.95104 WP_000404940.1.95106 WP_000404940.1.95113 WP_000404940.1.95125 WP_000404940.1.95128 WP_000404940.1.95153 WP_000404940.1.95177 WP_000404940.1.95192 WP_000404940.1.95208 WP_000404940.1.95209 WP_000404940.1.95219 WP_000404940.1.95240 WP_000404940.1.95258 WP_000404940.1.95276 WP_000404940.1.9528 WP_000404940.1.95303 WP_000404940.1.95312 WP_000404940.1.95321 WP_000404940.1.95322 WP_000404940.1.95333 WP_000404940.1.95369 WP_000404940.1.95376 WP_000404940.1.95413 WP_000404940.1.95458 WP_000404940.1.95479 WP_000404940.1.9549 WP_000404940.1.95528 WP_000404940.1.95531 WP_000404940.1.95532 WP_000404940.1.95553 WP_000404940.1.95583 WP_000404940.1.95602 WP_000404940.1.95605 WP_000404940.1.95688 WP_000404940.1.95692 WP_000404940.1.95698 WP_000404940.1.95707 WP_000404940.1.95722 WP_000404940.1.95725 WP_000404940.1.95732 WP_000404940.1.95736 WP_000404940.1.95740 WP_000404940.1.95762 WP_000404940.1.95765 WP_000404940.1.95769 WP_000404940.1.95778 WP_000404940.1.95807 WP_000404940.1.95853 WP_000404940.1.95856 WP_000404940.1.95868 WP_000404940.1.95870 WP_000404940.1.95876 WP_000404940.1.95879 WP_000404940.1.95881 WP_000404940.1.95904 WP_000404940.1.9592 WP_000404940.1.95933 WP_000404940.1.95936 WP_000404940.1.95956 WP_000404940.1.95968 WP_000404940.1.95998 WP_000404940.1.96011 WP_000404940.1.96016 WP_000404940.1.96024 WP_000404940.1.96048 WP_000404940.1.96049 WP_000404940.1.96081 WP_000404940.1.96096 WP_000404940.1.96100 WP_000404940.1.96103 WP_000404940.1.96106 WP_000404940.1.9611 WP_000404940.1.96111 WP_000404940.1.96117 WP_000404940.1.9612 WP_000404940.1.96126 WP_000404940.1.96138 WP_000404940.1.9615 WP_000404940.1.96181 WP_000404940.1.96189 WP_000404940.1.96227 WP_000404940.1.96231 WP_000404940.1.96244 WP_000404940.1.96249 WP_000404940.1.96277 WP_000404940.1.96292 WP_000404940.1.96307 WP_000404940.1.9632 WP_000404940.1.96321 WP_000404940.1.96336 WP_000404940.1.96350 WP_000404940.1.96397 WP_000404940.1.96421 WP_000404940.1.96432 WP_000404940.1.96436 WP_000404940.1.96464 WP_000404940.1.96466 WP_000404940.1.96487 WP_000404940.1.96499 WP_000404940.1.96564 WP_000404940.1.96565 WP_000404940.1.96582 WP_000404940.1.96594 WP_000404940.1.96595 WP_000404940.1.966 WP_000404940.1.96601 WP_000404940.1.96619 WP_000404940.1.96636 WP_000404940.1.96652 WP_000404940.1.967 WP_000404940.1.96703 WP_000404940.1.96709 WP_000404940.1.96713 WP_000404940.1.96728 WP_000404940.1.96749 WP_000404940.1.96772 WP_000404940.1.96781 WP_000404940.1.96812 WP_000404940.1.96821 WP_000404940.1.96833 WP_000404940.1.96851 WP_000404940.1.96872 WP_000404940.1.96873 WP_000404940.1.96875 WP_000404940.1.96887 WP_000404940.1.96888 WP_000404940.1.96889 WP_000404940.1.96901 WP_000404940.1.96913 WP_000404940.1.96939 WP_000404940.1.96961 WP_000404940.1.96974 WP_000404940.1.97035 WP_000404940.1.97040 WP_000404940.1.97045 WP_000404940.1.97048 WP_000404940.1.97051 WP_000404940.1.97070 WP_000404940.1.97073 WP_000404940.1.971 WP_000404940.1.9712 WP_000404940.1.97158 WP_000404940.1.97159 WP_000404940.1.97182 WP_000404940.1.97187 WP_000404940.1.972 WP_000404940.1.97210 WP_000404940.1.97252 WP_000404940.1.97284 WP_000404940.1.9730 WP_000404940.1.97308 WP_000404940.1.97354 WP_000404940.1.97362 WP_000404940.1.97381 WP_000404940.1.97383 WP_000404940.1.97436 WP_000404940.1.97476 WP_000404940.1.97479 WP_000404940.1.97485 WP_000404940.1.9750 WP_000404940.1.97524 WP_000404940.1.97526 WP_000404940.1.97543 WP_000404940.1.97553 WP_000404940.1.97556 WP_000404940.1.9757 WP_000404940.1.97570 WP_000404940.1.97582 WP_000404940.1.97610 WP_000404940.1.97644 WP_000404940.1.97657 WP_000404940.1.97658 WP_000404940.1.97686 WP_000404940.1.97702 WP_000404940.1.97733 WP_000404940.1.97808 WP_000404940.1.97810 WP_000404940.1.97824 WP_000404940.1.97829 WP_000404940.1.97831 WP_000404940.1.97856 WP_000404940.1.97859 WP_000404940.1.97862 WP_000404940.1.97866 WP_000404940.1.97875 WP_000404940.1.97876 WP_000404940.1.97878 WP_000404940.1.97879 WP_000404940.1.97880 WP_000404940.1.97886 WP_000404940.1.97891 WP_000404940.1.97901 WP_000404940.1.97925 WP_000404940.1.97931 WP_000404940.1.97944 WP_000404940.1.97994 WP_000404940.1.97998 WP_000404940.1.98044 WP_000404940.1.98049 WP_000404940.1.98057 WP_000404940.1.9806 WP_000404940.1.98103 WP_000404940.1.9812 WP_000404940.1.9819 WP_000404940.1.98192 WP_000404940.1.98198 WP_000404940.1.98217 WP_000404940.1.98245 WP_000404940.1.98265 WP_000404940.1.98270 WP_000404940.1.98277 WP_000404940.1.98286 WP_000404940.1.983 WP_000404940.1.98376 WP_000404940.1.98388 WP_000404940.1.98398 WP_000404940.1.98399 WP_000404940.1.98428 WP_000404940.1.98449 WP_000404940.1.98461 WP_000404940.1.98467 WP_000404940.1.98475 WP_000404940.1.98504 WP_000404940.1.98518 WP_000404940.1.98539 WP_000404940.1.98545 WP_000404940.1.98632 WP_000404940.1.98635 WP_000404940.1.98647 WP_000404940.1.98648 WP_000404940.1.98679 WP_000404940.1.9868 WP_000404940.1.98711 WP_000404940.1.98714 WP_000404940.1.98732 WP_000404940.1.98740 WP_000404940.1.98747 WP_000404940.1.98759 WP_000404940.1.98771 WP_000404940.1.98781 WP_000404940.1.9879 WP_000404940.1.98799 WP_000404940.1.98828 WP_000404940.1.98833 WP_000404940.1.98851 WP_000404940.1.98855 WP_000404940.1.98859 WP_000404940.1.98862 WP_000404940.1.98879 WP_000404940.1.98915 WP_000404940.1.98934 WP_000404940.1.98941 WP_000404940.1.98943 WP_000404940.1.9895 WP_000404940.1.98957 WP_000404940.1.98961 WP_000404940.1.98989 WP_000404940.1.98990 WP_000404940.1.99001 WP_000404940.1.99010 WP_000404940.1.9902 WP_000404940.1.99028 WP_000404940.1.99034 WP_000404940.1.99066 WP_000404940.1.99096 WP_000404940.1.99114 WP_000404940.1.99138 WP_000404940.1.99143 WP_000404940.1.99148 WP_000404940.1.9915 WP_000404940.1.99181 WP_000404940.1.99203 WP_000404940.1.99291 WP_000404940.1.99309 WP_000404940.1.9931 WP_000404940.1.99314 WP_000404940.1.99342 WP_000404940.1.99356 WP_000404940.1.99358 WP_000404940.1.99362 WP_000404940.1.99371 WP_000404940.1.99382 WP_000404940.1.99387 WP_000404940.1.99436 WP_000404940.1.99451 WP_000404940.1.99465 WP_000404940.1.99554 WP_000404940.1.99557 WP_000404940.1.99565 WP_000404940.1.99574 WP_000404940.1.99589 WP_000404940.1.99593 WP_000404940.1.99596 WP_000404940.1.99600 WP_000404940.1.99606 WP_000404940.1.99610 WP_000404940.1.99611 WP_000404940.1.99623 WP_000404940.1.99624 WP_000404940.1.99628 WP_000404940.1.99640 WP_000404940.1.99649 WP_000404940.1.99674 WP_000404940.1.99678 WP_000404940.1.99680 WP_000404940.1.99685 WP_000404940.1.99687 WP_000404940.1.9969 WP_000404940.1.997 WP_000404940.1.99732 WP_000404940.1.99753 WP_000404940.1.99760 WP_000404940.1.99781 WP_000404940.1.99790 WP_000404940.1.99793 WP_000404940.1.9984 WP_000404940.1.99853 WP_000404940.1.99879 WP_000404940.1.999 WP_000404940.1.99900 WP_000404940.1.99905 WP_000404940.1.99920 WP_000404940.1.99980 gi|169834322|ref|YP_001695114.1| gi|387759851|ref|YP_006066829.1| gi|116516869|ref|YP_817002.1| gi|221232472|ref|YP_002511625.1| 171101.spr1584 373153.SPD_1549 487214.SPH_1848 488221.SP70585_1779 488222.SPJ_1635 488223.SPP_1757 516950.SPCG_1713 561276.SPN23F_17420 gi|225859492|ref|YP_002741002.1| gi|405760397|ref|YP_006700993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]