SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4896.SPAC2F7.14c-1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4896.SPAC2F7.14c-1
Domain Number 1 Region: 199-328
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.65e-30
Family Eukaryotic type KH-domain (KH-domain type I) 0.00064
Further Details:      
 
Domain Number 2 Region: 105-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.48e-26
Family Cold shock DNA-binding domain-like 0.0000523
Further Details:      
 
Domain Number 3 Region: 56-105
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000000288
Family ECR1 N-terminal domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4896.SPAC2F7.14c-1
Sequence length 329
Comment (Schizosaccharomyces pombe)
Sequence
MVTILKPEEFYVSSEADIVNDVSMTEMEDEIMEDEQMGLVDGEDVLEEFDKSIHQNLVTP
GQLVTDDPQFMRGHGTYFEDGGIYASVAGSVQRVNKLISVKPLRSKYVPEIGDLIIGKIA
EVQPKRWKVDIGAKQNAVLMLSSINLPGGIQRRKLETDELQMRSFFQEGDLLVAEVQQYF
SDGSVSIHTRSLKYGKLRNGVFLKVPPALVVRSKSHAYALAGGVDIILSVNGYVWVSKHN
ENQHSSVSITRLEEEASESIYSNENDEIDGYTRLNISRVSICIKGLASRSLPLTQASITN
FYESSLVFSNLQDLTVPKNMDQIAMEAMQ
Download sequence
Identical sequences Q09704
SPAC2F7.14c___KOG3013 4896.SPAC2F7.14c-1 SPAC2F7.14c SPAC2F7_14c.1 NP_592984.1.19918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]