SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4896.SPBC3B9.22c-1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  4896.SPBC3B9.22c-1
Domain Number - Region: 2-64
Classification Level Classification E-value
Superfamily BAG domain 0.0667
Family BAG domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4896.SPBC3B9.22c-1
Sequence length 72
Comment (Schizosaccharomyces pombe)
Sequence
MNNPMEEQQSALLGRIISNVEKLNESITRLNHSLQLINMSNMNVELASQMWANYARNVKF
HLEETHTLKDPI
Download sequence
Identical sequences Q50HP4
4896.SPBC3B9.22c-1 XP_001713149.1.19918 SPBC3B9_22c.1 SPBC3B9.22c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]