SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 490899.DKAM_0925 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  490899.DKAM_0925
Domain Number 1 Region: 8-94
Classification Level Classification E-value
Superfamily SRP19 8.5e-29
Family SRP19 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 490899.DKAM_0925
Sequence length 95
Comment (Desulfurococcus kamchatkensis 1221n)
Sequence
MSRDNKGRRIVVYPAYIDSKKSRSEGRKISLGKAVPNPSIKEIIEASERLGLNPLYEEKH
YPRLKEGKGRVLVDKKSGKLEILRMIADEIRKMRG
Download sequence
Identical sequences B8D570
WP_012608592.1.40753 490899.DKAM_0925 gi|218884236|ref|YP_002428618.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]