SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 491915.Aflv_1529 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  491915.Aflv_1529
Domain Number 1 Region: 317-468
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.37e-31
Family HD domain 0.014
Further Details:      
 
Domain Number 2 Region: 209-305
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.04e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Weak hits

Sequence:  491915.Aflv_1529
Domain Number - Region: 91-137
Classification Level Classification E-value
Superfamily Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.0759
Family Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 491915.Aflv_1529
Sequence length 521
Comment (Anoxybacillus flavithermus WK1)
Sequence
MRIMGETIISALLALVVGAVVGFFVRKSIAEAKIGGARVAAKQIIEEAKREADALKKEAL
LEAKDEIHKLRVEAEREIRERRSELQKQENRLLQKEENLDRKDESLNKREALLEKKENSL
NERQQHIEEMESKVEELVRKEQAELERISSLTREEARQIILDRVEKELSHEIALMVKEAE
TKVKEEADKKAKEILSLAIQRCAADHVAETTVSVVNLPNDEMKGRIIGREGRNIRTLETL
TGIDLIIDDTPEAVILSGFDPIRRETARIALDKLVQDGRIHPARIEEMVEKARREVDEHI
REVGEQTTFEVGVHGLHPDLIKILGRLKFRTSYGQNVLKHSMEVAYLAGLMAAELGEDEM
LARRAGLLHDIGKAVDHEVEGSHVEIGVELATKYKEHPVVINSIASHHGDTEPTSIIAVL
VAAADALSAARPGARSETLENYIRRLEKLEEIAESYEGVEKSYAIQAGREIRIMVKPDMI
DDLEAHRLARDIRKRIEEELDYPGHIKVTVIRETRAVEYAK
Download sequence
Identical sequences B7GJN2
gi|212639360|ref|YP_002315880.1| 491915.Aflv_1529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]