SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4924.PICST_40963 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4924.PICST_40963
Domain Number 1 Region: 120-207
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.23e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4924.PICST_40963
Sequence length 356
Comment (Pichia stipitis)
Sequence
MVSTHNRDKPWDTADIDKWALEEFKPEHNASGQHFTEESSFMTLFPKYREQYLRSIWADV
TKSLEKHFIKCELDLVEGAMTVKTTTKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD
IACDVIKIGNFVANKDRFIKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
KEVRRVVEDCMRNVHPIYYIKELMIKQELSKKPELAEEDWSRFLPSFKKRNVARKKAKSS
KREKKVYTPFPPAQTPRKVDLQVESGEYFLGKKEKAMKKLKEKREKQEEASVARKQEREK
DYVAPEEEKYENKLAKKEKKEKKEKKEKKEKKEKKEKKKRSASEEEERGSKKSKHA
Download sequence
Identical sequences A3LNJ9
XP_001382899.1.38308 jgi|Picst3|40963|e_gwh1.2.1.2136.1 4924.PICST_40963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]