SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4924.PICST_53344 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4924.PICST_53344
Domain Number 1 Region: 143-276
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000673
Further Details:      
 
Domain Number 2 Region: 286-315
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000279
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4924.PICST_53344
Sequence length 392
Comment (Pichia stipitis)
Sequence
MKAPTPVVDDSLATRWAGKPSRYKKFDSIRLDTIITGHLTQEQADAYQQYFRIEETSAIL
RIAQQQRKPILGLLPSGNLEQNPHFKREPSPPPKYDNFGNRINTRELRTVAMLEKERNFL
VEEVASRIKNYVPPADYRKPAKTVEKLYIPVKDYPDINFMGLLLGPRGNTLRQMQEESGA
RMQLRGKGSVKDGKSATDDDDTGGEMTSTSFSNPTLDSNTDDMHVLITADAQHKIAIAIK
LANEVIEKAISSPVGQNDLKRGQLRELAVLNGTLRETKPYNPEARVQRKGLDISQIVCKS
CGGIGHYARDCKPTSGIVPPLPVGIKPPAPPPPPATGFPPPPPPSVKPPPPPSAAKPPPP
PSEVKVPPPPPEVKVPPPPPEVKVPPPPPPSS
Download sequence
Identical sequences A3GHC4
4924.PICST_53344 jgi|Picst3|53344|e_gww1.1.2.288.1 XP_001387052.1.38308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]