SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4924.PICST_66417 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4924.PICST_66417
Domain Number 1 Region: 2-266
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.41e-43
Family Calponin-homology domain, CH-domain 0.00059
Further Details:      
 
Weak hits

Sequence:  4924.PICST_66417
Domain Number - Region: 545-613
Classification Level Classification E-value
Superfamily EF-hand 0.0659
Family S100 proteins 0.086
Further Details:      
 
Domain Number - Region: 401-479
Classification Level Classification E-value
Superfamily t-snare proteins 0.0811
Family t-snare proteins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4924.PICST_66417
Sequence length 660
Comment (Pichia stipitis)
Sequence
MKEDAWVDLQQRTLVRWLNSKLMEDSESEATPTSSLGRSSITNLRTDLQDGIILIKLINW
LVYEITSNENHPLTKRNTKLYYLTPIYKKPTFKLQKLENLNDFLKFINLILNVNVCNISA
DNIYEGDLKLTLGLLWSLFVFSTANSFTFKNANTSFVEIKSILLGWVNDILAKRNSRVSN
FNKDWSIDINRPDRILADILHYYGIRFETQKSENDENHNLKKLTLVLSYIENKLMIPHLI
DTDDFAVLVPDEKCIVIFLVELYKVFEIEGHFFEDEEAARSETETEIQYVFDDILSMSIE
TSREKNKYETRALRFLNKTNSLLGQLNEGYESLQDINAGNLLETDLTKCLEMLKTALTEP
TIENLNHFMGFFSHINIKMTSLVKVSQTFENYKQNIKPDLVYKDFTSISNLVKSVRANLQ
KIDLLYYPSIKSLNIEAMSDKLNELMELESKFSASANTLVEALKKEASQLHTHLKIIEDN
NLREVDEKLPHKDWLLRCLDYFDYLVNFYARLDHFSTLLNAPIPTAELKKVMETNGEYEG
ACKDYKLSPEIFISFKEAFVRQDNFINHFELVRFLKSNVSADVDPSTIEMFIKLIPTKSV
QTLISSASFSSGYSFSFSESEDDYIFDELQKKVDSQLSGTIDRVYDIHDFIEQFETGFKI
Download sequence
Identical sequences jgi|Picst3|66417|estExt_fgenesh1_pg.C_chr_1.10490 4924.PICST_66417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]