SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4924.PICST_68153 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4924.PICST_68153
Domain Number 1 Region: 857-994,1025-1224
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-40
Family p120GAP domain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 144-286
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-33
Family Calponin-homology domain, CH-domain 0.0000631
Further Details:      
 
Domain Number 3 Region: 1456-1558
Classification Level Classification E-value
Superfamily RGC domain-like 7.85e-25
Family RGC domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4924.PICST_68153
Sequence length 1564
Comment (Pichia stipitis)
Sequence
MMLQSPTRSNVAARYLESIGDSASSTPNRLPLQPTLKYNQTSKESTDLDVLAKQLNVPTS
PTKTAFLRTKFESPSATVSSFKTPRTKTSSNNSSRNSTPLKNSTNLNLEAKPNLSKNGDH
SNLKHPTSFWKLRPDLKPDLFYSPGYEYLCRIQAIKNWLELVLQEEISQSPVELISYIRN
GIFLAKLANVILPTKRRVFTEDSKLQFKHTENINRFFHLLDFMNVPDLFTFELTDLYDAK
NVPKVWFCLHALSYLMNMSNSGYPKIENLVDKLDFSEDDIRSANRALVGAGLPNFASADN
GNDSTSSDNTYMNRVAADSPIKVTTFSASKGSQSSFTKKQDSHPNPFEDTTKSSASLNSF
HKELTKKSVPSTTKTPSTFKTPIASQSRISNFYTPELDSHIENIVKLQSLARGANFRYSM
FVDKIMIKSYSDEFTYFFSIARGKLSRDKTIHRHRGELIPFKEEIVQLQSIVRRKLYSQG
KPKMDGNTERIVKFQSKIRGLLERRRISTLKLQMIAQKDNVSELQAIMKMKKIHYRVSTV
CQSRYQIEPSVLELQSICRRRLQERRAARHLIDEDSIVEFQSAIRSLRIRNHIRSIRSTI
TKQIEPLEELQSIARGGLARSRLCNSVLITLLYEDEVLNNLYAVFRGNKVRKEMAAKKSA
LQSVRKSSIIPLQSAFRGLYCRFEKDIKLDDVYCEVDSIIQLQAILRGARVRNDSRYMKE
YYQKNINSVIKAQSLIKKTLVQNAYKTLLNKKNPPLSVIRRFAYLLSDSDLDYQDEMELS
EAKDQIIDRSRSNEELENRIENLDIKLNLLDRNKITVEEFLKHKSKFKNNKVKDTKGGAT
TMKCLERLNKSSRERVELYQSMFYFLQTKPIYFVRLYKTMSVEKNGSKFNKDLQNFVMSL
FPIKDSSVKHHCREEYYFVKLISELMKNDVENNSRSISDLTKTSTTFWIDYFLLFNNHTY
QRQHLKHLVGKFVYSVIESDMLDFESDPSEIYEAIVEREHRVNGFSERPRGISPQHAIKE
EDVSAKFVNNLMNLREVATEFLNTLELSADRVPLHVKVICKQAYELSQLQFPEKSDQQHL
AVAGVVFIKHYIAPILQFPENFGFQNKDFYNPKARDNLKHLSRVMLQVFSMKPFSDSFLK
PLNDYVTSSTEMTRRLIMNLISVKDLENEYELDDYNDIVSHERPKLTMNVSNMISLEKII
SQHIDLIAPSSDDQLYRINTQLEEVVNSADDYVTLTELGSITLNLNPATKEDSIADSKNK
SLFTQAKRCVLYIIRIQEGNGLLDLLISGIKPADEIKFREIVTAERKEMEQSSINARRKP
YYKTSLGDLSKITYHDLKKMALEIILKLEVSAQLTRKNSFQELLNQIAIDIKTKDSQRVS
RKTQLEIANKTLSKLKEKEIFLKKQLADYNKHVDTILSQLQSKPKDRMLFNIIPVFSKQY
FYHRELKKNNRLPQFGSYKYSARKLVEQGIIIDFGGLLNRAHSSSSKLDFMFSCHKAGKF
TIEAANGSVTIPGACYNITLDELLNYQYENKESFDAFDGMVMFNTNNLAAFIFRKFYDIN
RDSA
Download sequence
Identical sequences A3LY27
XP_001385593.2.38308 4924.PICST_68153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]