SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4924.PICST_76889 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4924.PICST_76889
Domain Number 1 Region: 100-177
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.33e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00063
Further Details:      
 
Domain Number 2 Region: 186-258
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000541
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 3 Region: 405-491
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000264
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Weak hits

Sequence:  4924.PICST_76889
Domain Number - Region: 319-395
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0149
Family beta-sandwich domain of Sec23/24 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4924.PICST_76889
Sequence length 500
Comment (Pichia stipitis)
Sequence
MSSNSNILKRKNDDLESSAGDQLNKRVALDSEQLDLNVIQQEQSQTAPAIGSSVTGEVVE
PVEVSAEAIHEASAEKTETRCRSEHASGSKPISNHRERDSDPTYVSIRMYCPVKEASCIV
GKKGEKINHIREKASVRINVSENLKNVPERIISVRGPAENVARAFGLITRTILDEPEDEP
ASMISQQYNLKILVPHPMIGFIIGKQGSKFREIEENSAAKLKAAEQPLPYSTDRILSITG
VGDAIHIAIYYISQVMLEHKDCLKKNKIIYYNPANFHHSNVSNSMMNISMVSNNNNMNNM
MVMGPNAMSLPMKDNNMANPYGQKPQPYGQHQNKPPQQHQHQQQQQPYNFQMMFQPAIHP
QHHYGAMAPAAAPPPPIQMPSQTPYTDEHGNTIIGEVITNPPVQSGPTPDKLNQDVFVAN
ANIGSVIGRRGNNIKHIRENSGCTYVKIEPDKGQSIMLGGGKGLTNIRKLTLTGTLSSIQ
TAIFLINQRIAADKERNALH
Download sequence
Identical sequences A3LRG0
4924.PICST_76889 XP_001383407.2.38308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]