SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4924.PICST_86979 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4924.PICST_86979
Domain Number 1 Region: 640-727
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 2 Region: 720-802
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 3 Region: 963-1040
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000409
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 4 Region: 160-261
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000526
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 
Domain Number 5 Region: 1124-1216
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 804-885
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000731
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 7 Region: 878-962
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000716
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 8 Region: 560-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000628
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Weak hits

Sequence:  4924.PICST_86979
Domain Number - Region: 312-392
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4924.PICST_86979
Sequence length 1217
Comment (Pichia stipitis)
Sequence
MPTPAEIIAARVNNDDYNGNGSGEDAASVISSAGSAGVASSATAPSIADESAFPALGGKK
LPSVSGVVTPLWGPSMKTPVSGSVSPTPLAKPKPAVVGTNGHRVKVSTIQEAFSLDAEDQ
LNVARLDFIKILTTVKSDTNTNIECTTSQHTKKRTFLITGKPEDVRLAKRTVIKKLTKPV
VLSFSVPAKVRSRIIGPQGKNLKPIILANDVKIDIGNPEDDVEDEDEDEDDIFSKTVTIT
VSGDVEGCKRAKAQINAIVKEETKNLSVKVKVDDLVKPFASVALNPVVSKYLSLDINVPD
YKSGSATILIVGDRELALEAKAEVKDILDALSTKLTTEEVPIPKIKHQFLPIGAILEEDH
VFIQLPSEGEANVKFIGEKKKLAAAKEKARQTTSSYKVEVLDMLKAHKGNLKHVKAVAAL
LNQNGVFKQIAGEHEVSISVPSTKTLSDESIASIPIEIVCKDDAEKIKTVRKAIVQVVNK
ITPDQTKVIDDIDAFLIGKVPETIKAVAKQSKVSYVILGSNITLFADEKEAEESDDFDDF
ESSDSVSFTEVEEALDGLRKLAANLESVVLNVPSKEQSTVSGPRGTTLKSILKGVEANSV
EVKLHHDGSKSSDDSIYIHGVKSEVSKVKKDVEAVLADAQEYKDGYTATISVPSTVLSRL
IGKSGANLNALRDEFGVKIDVADEGKEADSKDKTGKTDIVVSGIKRNVEEAKVDIQQLSK
RWADETLVTLKIESQYHRRMIGQSGVYINRLQDKYNVKIRFPSADGKTSDFADAPKSKDE
VTIKGPSKGVAKAEEELKELYKYEKENGFKQTIQIPVKAIARVIGKAGETINDIADGSGI
EYKFNRNTESEESLGYAEVELTGAKSALKEAINKINEIIEEIENFASVTIKVDPKYHRDL
IGQAGSVMKEIISKAGGDDLPRNRYFKLLSIPNEGSGSDEVTSQGDKSIVDKVIEQVKKI
IATKEASVTEDYELPKEKHRLIVGPSGSIRHSLQEEFGASIEIPRPNDASTIIKLSGLPE
KIEGLKTKIAELTKDDWVLSVDVPQAYHALVSEKGAIFKKLKSDYNVEVQHGNLTRQAAK
LSSSSIPTPPQEAFPTDDAATKFTIVDNAPVEESDVVIPWRLKGDEEGAKKAAKLIEERL
ANAKAATSVGWFYSKNPSTFSKIVGPQGSKINQIRKKSSTFITVPRSNDKNPNFVYLIGS
AENLEVASKEIENALKN
Download sequence
Identical sequences jgi|Picst3|86979|estExt_gwp_genewisePlus_human.C_chr_1.20904 4924.PICST_86979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]