SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4929.A5DBU1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4929.A5DBU1
Domain Number 1 Region: 196-275
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.47e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00097
Further Details:      
 
Domain Number 2 Region: 282-358
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000818
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 3 Region: 456-538
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000109
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4929.A5DBU1
Sequence length 545
Comment (Pichia guilliermondii)
Sequence
MSDNTLKRKIDEQEEEEPPIKRAALDDTSSKSPELEGPPSPVLGADSTEDETNKPSSNKP
EPLNPSESDDDYQVEPPKEDSSKLTDKSTDVSPSVSVPSHSAPPSTISYPQPSPPPASPP
RQSPYSRSSALGQLGSLINAYGTSTPAINPITNSGVSQAIGTTTSYGTSQAYDPVPFANH
LDYTSRPMANHQAERESDPTYVSFRMYCPVKEASFVIGKRGDMINHLREKANARIQVSEN
IKDVQERIISVKGPAENVAKAFGLITRAILEEPEDEPASIMSRQYNLKVLIPHPMVGYII
GKGGSKFREIEENSAAKLKAAEQPLPNSTDRVLSVLGVGDAIHIAIYYISQVIIEHKDIL
KKHKIVYYTPGNNQLMNNTMGLIPNNTYGNTGIIGNDPIQGGAPFQHNYQRQFQPSAPSH
NQITTPVPTQSYTDEHGNTMIGDVITSVPVPAGTGTDKFSEDVFVANTNIGSVIGKGGNN
IKQIRESSGCSYVKIEPDQHQTIMLGRGRGLTSIRKLTLTGSINSIQTAIYLINQRIVAD
KERNM
Download sequence
Identical sequences A5DBU1
4929.A5DBU1 PGUT_00746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]