SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4929.A5DI55 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4929.A5DI55
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily t-snare proteins 5.34e-20
Family t-snare proteins 0.0027
Further Details:      
 
Domain Number 2 Region: 132-198
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000436
Family SNARE fusion complex 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4929.A5DI55
Sequence length 228
Comment (Pichia guilliermondii)
Sequence
MDPFDEVKEDAWSQVNGLQEFVNKNRPQNETKLDFENAFQELQETIGDLRQAVTISEANP
DQFQLNSNDISHRKDILAQLDAKVTSISKQWSSKNDPHRPRDVTTMSNRISQDTHEENPF
NDSNRLDEEFNAYQQQEVIQNQDLQLDQIHQTMRNLNLQATMMGGELEDQGMMLDDLDQE
MDVVGSKLQRGLKRVGFVIEKNKERASDWCIGILVVALCVLLIIVIAI
Download sequence
Identical sequences A5DI55
4929.A5DI55 PGUT_02956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]