SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4929.A5DI93 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4929.A5DI93
Domain Number 1 Region: 51-194
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.75e-25
Family Ypt/Rab-GAP domain of gyp1p 0.0049
Further Details:      
 
Domain Number 2 Region: 171-281
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-17
Family Ypt/Rab-GAP domain of gyp1p 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4929.A5DI93
Sequence length 317
Comment (Pichia guilliermondii)
Sequence
MMQVEHRGRKRDSIEHFIGLPQIFLANGLAQLRYMVLVEGLQTPQGYDQCPYRCYVWSIL
CKVPTFPTDKYLALVQSASSSISSEMYQKIKNDTFRTLMHDRHFHSKVSESSLIRILSCL
AISIQSKVGYVQGLNVLLAPIVYACHKSEPQAFAILHSLVTNQIPLYITPNLDGVHTGLA
LVDVVLKIIDPVLSEYLDSKFLKAEIYAFPSVLTLGACTPPLKSVLKLWDLLFAYGTHMN
ILFVVAQLVINRSQLLNSPQPMKLLRSFPPLEENEIIKLSLSFIPELPKQLYDMTSRHGY
DADVPGELKAFLAENNL
Download sequence
Identical sequences A5DI93
4929.A5DI93 PGUT_02994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]