SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4929.A5DJH5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4929.A5DJH5
Domain Number 1 Region: 256-331
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.33e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00093
Further Details:      
 
Domain Number 2 Region: 50-129
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000101
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 3 Region: 153-242
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000708
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4929.A5DJH5
Sequence length 342
Comment (Pichia guilliermondii)
Sequence
MTESLFDTKFTSESLSAGNEAAPVVSTPQNDPPATPIGQDEKVSTSLPSVEDMSNASALI
NYRVLVSAKEAGCLIGQNGQVIDSIRQETNTKAGISRLQPGSHERILTVSGTLDDAARAL
SYFAQALCNANTETFSTYSYFPLKQLSSTPCVEGETTILRLLIPNAQMGTLIGSKGVRIQ
QIQANFHISMIASKSFLPGSNERLVELQGTVNDLYDTLRVISRCLIEDFSSIVTTSYYIP
RGGNTTKYRGTDRRSSSPGISTTLYFPNEIVGALIGKNGSRIQGVRKVSGASIGISEEVD
GKTEREFTISGSSHAVEKAKDLLYHNLEREEQRRAEAANTAE
Download sequence
Identical sequences A5DJH5
PGUT_03426 4929.A5DJH5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]