SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4929.A5DJI2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4929.A5DJI2
Domain Number 1 Region: 140-645
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.76e-166
Family Calponin-homology domain, CH-domain 0.00000000000298
Further Details:      
 
Domain Number 2 Region: 7-86,163-184
Classification Level Classification E-value
Superfamily EF-hand 0.00000000109
Family Calmodulin-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4929.A5DJI2
Sequence length 648
Comment (Pichia guilliermondii)
Sequence
MNVLKLQKKYPVLDQSELFGIIEDFRNIDIEEKGWAEKKDVINAVSKRGNYTYDEARETL
KEVDVDASGHVELEDYVQLMAKLKEEASGGLKPNAAPIPTSPRPSTGGDGFATSPTPKSP
AGAAKKKYIGGKTSGTTHTINDEERIEFTRHINSVLAGDPHIGDRLPFDTETFQVFDECR
DGLVLSKLINDSVPDTIDTRVLNMPSAKKKVLNNFQMSENANIVINSAKAIGCVVVNVHT
DDIIDGKEHLILGLIWQIIRRGLLSKVDIKLHPELYRLLEDDETLEQFLRLPPEQILLRW
FNYHLKNAGSERRVANFSKDISDGENYTVLLNQLQPEHCDLSPLKTSDLLQRAEKVLSNA
DKIGCRKYLTPTSLVAGNPKLNLAFVAHLFNTYPGLDPIEESEKPEIEDFDAEGEREARV
FTLWLNSLDVDPPVVSLFEDLRDGLILLQAFDKVLPGSVSLKHANQRPASGAPISRFKAL
ENTNYAVEVGKASNFSLVGIEGSDIVDANKLLTLGLVWQLMRRNIINTLASLRSGGHNVS
DSDILKWANEKVQKGGKSSTIRSFKDSSVSSGVYLLNVLNGLKPGYVDYDLVYQGNNLSD
DEKYANAKLAISIARKLGALIWLVPEDIIECRARLILSFVGSLMCIDS
Download sequence
Identical sequences A5DJI2
4929.A5DJI2 PGUT_03433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]