SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4929.A5DMP2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4929.A5DMP2
Domain Number 1 Region: 169-211,247-329
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.31e-34
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 75-167
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.1e-25
Family Cold shock DNA-binding domain-like 0.0000532
Further Details:      
 
Domain Number 3 Region: 24-75
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000105
Family ECR1 N-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4929.A5DMP2
Sequence length 330
Comment (Pichia guilliermondii)
Sequence
MSVISISAPVNIDSDSDMSDDDTSRAIVTPGELVTDDPSWMKGHGTYFLNEKTYSSVAGN
VSRVNRLLSVIPLRGKYQAETGDHVVGRITEVGNKRWKVDIGCRQDAVLMLGSINLPGGV
LRRKSESDELQMRNFLKEGDLLNAEVQSTYASGMVALHTRSLKYGKLRNGILLQVPSSLV
VKSKNHSYDMPGNVSVILGVNGYIWISKTTSYQSSATNAATNRAQASIESQAGYNPGQAS
VAITRLEEESSWEIYSDKNDPISDTIRNNITRYYNVIRALSYGELGITEQRIIMGYEASL
AYTDDVSLIDKEQMETLCSDVINNELMRGN
Download sequence
Identical sequences A5DMP2
PGUT_04543 4929.A5DMP2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]