SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4929.A5DPZ7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4929.A5DPZ7
Domain Number 1 Region: 2-238
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.45e-42
Family Calponin-homology domain, CH-domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4929.A5DPZ7
Sequence length 602
Comment (Pichia guilliermondii)
Sequence
MDDAWVNSQRKTMTRWINSVIQGESVAPITNLEQDLSDGLVLYALVNNMLKTSNSDYSGT
TLTPLYKAPKFKLQKVENVADVLEFLRVALQVNVCNISAENIVDKNSKLVLGFVWSLYMY
SSTSTLSKAHEDCNTFHKIKKILLDWVNSIIIKKDLRISNFDRDWSIQENRPDLILWAIL
DHYNPENKPYRSEKKIQNLQAALDRANELGINLSDIDDYLVLVCDEQCIVTTMLEWFKYF
EIEKAAPTRVLDKFIEQIVDAVALKRQYESDLKLYFGKIERISAGMKSNLDVIESDSSTD
TCELLHRCCTFFDIIVMAESDEDLVHTMDALQCILQMVESSYTSLLDAFEDFETYGKSMK
PQIVDEEYEKLTSRLQLLQEKLQQLGTYYEPSDVSNPSKLLVKLSEVADMETKFVEKSEV
VVKGLLQVKFPNQRADQEGCSEWRRNTIKSCLAKFQSFDKIRNNLQDFLGRFDKTFPLEK
IRRGFAMPKPDAEVCDDIDYFELQMETSVTTEVKLFDAILNKVSEDISVDLITSFLNLIP
SETKKFERSESDFTLNYPSDESDDSNSVFDEVQRSLGSQLAGPQRVYDIKQFLYRIRNGF
QV
Download sequence
Identical sequences A5DPZ7
4929.A5DPZ7 PGUT_05348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]