SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4932.YCL059C from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4932.YCL059C
Domain Number 1 Region: 120-223
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.33e-20
Family SCOPe 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4932.YCL059C
Sequence length 316
Comment (Saccharomyces cerevisiae)
Sequence
MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV
TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI
RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA
KDFIAPEEEAYKPNQN
Download sequence
Identical sequences A0A0L8VU58 A6ZTD6 B3LU25 B5VEQ2 C8Z430 E7LRT8 E7QBZ1 H0GD46 P25586
YCL059C 4932.YCL059C YCL059C YCL059C NP_009872.1.97178 5wlc_NK 5wyj_K1 5wyk_K1 YCL059C YCL059C YCL059C YCL059C YCL059C YCL059C YCL059C YCL059C SCRT_05351 YCL059C YCL059c___KOG2874 YCL059C tr|A6ZTD6|A6ZTD6_YEAS7 YCL059C YCL059C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]