SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4932.YER016W from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4932.YER016W
Domain Number 1 Region: 3-121
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-36
Family Calponin-homology domain, CH-domain 0.0000368
Further Details:      
 
Domain Number 2 Region: 198-280
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.000000000000484
Family EB1 dimerisation domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4932.YER016W
Sequence length 344
Comment (Saccharomyces cerevisiae)
Sequence
MSAGIGESRTELLTWLNGLLNLNYKKIEECGTGAAYCQIMDSIYGDLPMNRVKFNATAEY
EFQTNYKILQSCFSRHGIEKTVYVDKLIRCKFQDNLEFLQWLKKHWIRHKDESVYDPDAR
RKYRPIITNNSATKPRTVSNPTTAKRSSSTGTGSAMSGGLATRHSSLGINGSRKTSVTQG
QLVAIQAELTKSQETIGSLNEEIEQYKGTVSTLEIEREFYFNKLRDIEILVHTTQDLINE
GVYKFNDETITGHGNGNGGALLRFVKKVESILYATAEGFEMNDGEDELNDKNLGEHGTVP
NQGGYANSNGEVNGNEGSNHDVIMQNDEGEVGVSNNLIIDEETF
Download sequence
Identical sequences A6ZQW4 B3LS28 C8Z717 E7QDS9 G2WCP8 N1P3X9 P40013
YER016W YER016W YER016W YER016W YER016W YER016W YER016W YER016W YER016W YER016W tr|A6ZQW4|A6ZQW4_YEAS7 YER016W YER016W YER016W SCRT_04485 YER016W YER016W YER016W 4932.YER016W NP_010932.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]