SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4932.YLL032C from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4932.YLL032C
Domain Number 1 Region: 484-563
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 
Weak hits

Sequence:  4932.YLL032C
Domain Number - Region: 412-451
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4932.YLL032C
Sequence length 825
Comment (Saccharomyces cerevisiae)
Sequence
MDNFKIYSTVITTAFLQVPHLYTTNRLWKPIEAPFLVEFLQKRISSKELKNTKAICHIDP
SWVNLNASFIRDDMISIKATTDDMDLDAICRISLPLPMNTNDLTAELEKMKRILLDLSEK
FNLELIITKEPAYFTPEQTGESKELCIYVHALGFRSNLMECEPQLLAFVDLIKKNGMTLP
PQHYIIEPMELNSYSVLPLYMGVDMENFKHISRAFKTSIYAPSLITLSRDLKANPQIFFS
GAVHSLSLLARKTLRESISVNSKSFFYRRLTNITPGKLLFIRKYYQQKVNQLILKYQSLI
RVTNEYIEFQSISTNLLEMVIKNFTIQVLHEIVEVQISLNENCAMSPELIIDSFFGHTGN
QIVVITPKEDSFNQLIVVGNQSSTDEASDTSILHYLSDFIMGSNQVINPNLRQIKAIFEI
HPDFEDFISGKKNGKLTRIMELSACLIQLEMEEEDDNLYLNLVSDSFPDFKESFKNVINE
FPAEESFFIPEVCHRPIIGTGGSLIQATMRKHNVFIQFSNSFNLPQNKISMIRYDNVIIR
CPRKNKANICLAKNDLKQIVQEYDSLQSKTLIRFSSGQYRHILHVNGQKNIIGQIEKNEN
VYIMIPLKEPLDGTSQLSIQGNDENASRAANELVNSAFGYEYEFKIDQEIDPNKEYEFYN
LIVVPFLQIMNIIVTFEKDLITFTFEKDTNENTLTKAIELLSNYLETQKTKIIFKKIIKK
FVLGSASSKSNTSNSNTNGNFRSMNNAKSRTTIDNTSQSGASPQRHKMPVITTVGGAQAI
KGYIPNTYYNGYGYGYGYTYEYDYNYANSNKAQTNNRHKYQNGRK
Download sequence
Identical sequences N1P1E3 Q07834
YLL032C NP_013068.1.97178 YLL032C YLL032C 4932.YLL032C YLL032C YLL032C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]