SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4932.YNL231C from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4932.YNL231C
Domain Number 1 Region: 142-305
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.17e-50
Family CRAL/TRIO domain 0.062
Further Details:      
 
Domain Number 2 Region: 36-126
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 2.86e-18
Family SCOPe 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4932.YNL231C
Sequence length 351
Comment (Saccharomyces cerevisiae)
Sequence
MFKRFSKKKEAPEDPKNLINIDKPIKELPASIAIPKEKPLTGEQQKMYDEVLKHFSNPDL
KVYTSEKNKSEDDLKPLEEEEKAWLTRECFLRYLRATKWVLKDCIDRITMTLAWRREFGI
SHLGEEHGDKITADLVAVENESGKQVILGYENDARPILYLKPGRQNTKTSHRQVQHLVFM
LERVIDFMPAGQDSLALLIDFKDYPDVPKVPGNSKIPPIGVGKEVLHILQTHYPERLGKA
LLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFVKYVPKNELDSLYGGDLKFKYNHDVY
WPALVETAREKRDHYFKRFQSFGGIVGLSEVDLRGTHEKLLYPVKSESSTV
Download sequence
Identical sequences A0A0L8VJ77 B3LP72 B5VQH9 C7GPC8 E7KHF1 E7LZ83 H0GMA6 P53860
YNL231C YNL231C YNL231C YNL231C YNL231C YNL231C 4932.YNL231C YNL231C YNL231C YNL231C 4m8z_A 4m8z_B NP_014168.1.97178 YNL231C YNL231C YNL231C SCRT_03356 YNL231C YNL231C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]