SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4952.Q6C179 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4952.Q6C179
Domain Number 1 Region: 500-544,631-655
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0056
Further Details:      
 
Domain Number 2 Region: 176-277
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000872
Family Eukaryotic type KH-domain (KH-domain type I) 0.0094
Further Details:      
 
Domain Number 3 Region: 425-496
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000468
Family Eukaryotic type KH-domain (KH-domain type I) 0.0065
Further Details:      
 
Weak hits

Sequence:  4952.Q6C179
Domain Number - Region: 303-348
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0614
Family Eukaryotic type KH-domain (KH-domain type I) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4952.Q6C179
Sequence length 994
Comment (Yarrowia lipolytica)
Sequence
MDIIVAIPLRYTYLYPPTDYMWHVGNVFRPLDQETERFRTRLAAKPDTKEVLDNLVSLRK
VVSEISDVKANLEERRLVENTVTVSLMGARQAVQTERTRILRAYTAVARGHVALEDRVVS
QRGDDLKEGLTEIATYCNVSIYVTNNVDKVTYGLGYSGGSVSSSDAQKPFHVLIYGDQEL
VQYAQLRVEILIHKLMGSFIDAIEVPLSMQPLIAGCQLLNVKNIEAQSHCKILFPNWLPE
LFHVDEEMNLNYDTVFVVGPTQHHTLLAKTLIAEIKNKTQTIYKDCLGSYAKIDLMCLKY
QQRLKEVMQKLGAFIQVPFLGASRSVIRVTGISDTHVEQAIAEVMLMASGSYHAGFWAHT
GQEDPATNTYVGVDVKYTEDYLSFIDLVAGTSGATVSCSGSSFEVSGFKADVKRAVSLLA
KAPFWPNAQCQLRFRLELPLSEFEFVTGKKNGKINRIMDSSKCFIKLSPFHEYNFFLDIV
GDDSGKVLTGVQLLEEEFPSETQFYIPETYHKQVIGSGGHLIQTLMRKYNVFIKFTNGYD
RAPNGYSHHRFDNVLVRCPSKNSANIAPTKSDILETATKRAGDHGNTFIKVSRSHRRILM
MENDLFINIAEGQWNTCVIFPSIEPSDICDNDEVEIRGLLGSSAEAAHVIKNSLPNDYEF
KVAYSNRFAEVCSEDNPEFFSKIVVPLRVALKIHLQVYPEPRVMSGQNLLGQTDYDSPRY
QRIVLSFTLEHAPGLEEAILALTTYLREKELDIIDRGDLVQDVIRQGSVPLNTGSSERIV
EEEHNEQEPRAAKFFDVVPGDSRDRDSRPSSRDHSGPFGGRGGPGGGDGGYPNLPYRDPY
YQYPDHRDYDQFDGPPGQQEYYEKYRNPRFRSPVRGGPPGGGMNRDSRDQHEYDQYAQQQ
QQQYYGGGGRGGGRGGPGQGGHSGPPGGPYNREQRFFGGNNSAPPPGPPGPPGPPGPPGP
PGSNPGSEQSGDFRGRGYNDDQRDRKRFQPASYY
Download sequence
Identical sequences Q6C179
gnl|GLV|YALI0F18546g XP_505583.1.88470 4952.Q6C179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]