SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4952.Q6C2I6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4952.Q6C2I6
Domain Number 1 Region: 5-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-81
Family Calponin-homology domain, CH-domain 0.0000396
Further Details:      
 
Domain Number 2 Region: 251-370
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-23
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 3 Region: 473-604
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000171
Family Calmodulin-like 0.0098
Further Details:      
 
Domain Number 4 Region: 372-478
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000309
Family Spectrin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4952.Q6C2I6
Sequence length 616
Comment (Yarrowia lipolytica)
Sequence
MSLPQWIATQHKAFLRWANTYLEANQIGTMVSLETDFCDGVRLCQLIEIIGKESLGRYSG
QPRMRFQMIENVNTALAFIRHRGVQLHNIGAEDICDGNLKLILGLLWILILRFTIEDISE
EGLSAKEGLLLWCQRKTAGYKGVAVKDFSGSWSDGLAFCALLDKHRPDLIDFAQLDPTKP
RENMELAISIATEQIGIPQILDVEDICGVAKPDERSVMTYVAYWFHAFSALDMIENAGRR
LEKFVEMTSSAYAMQSGYEERMKALLKAIATQKEKWEQAADPEHLAYVEVKQQTAEHATF
KIKTKREWTREKASLASLLGNIRTKLATYNLKEYSPPVGLRSADVEAAWKELHMGEINRS
KLLNQSMRRLKESLRKRFADAANEFSDRLSVLSTAISQMDGPLEDQLEEIADISEKLRPL
TEKIRLLKELDTSCVEANVEENDYTVYSYDELEYDLGLAKESVKKKLAFIENQIVARNMT
NLTPIQLEEFESVFRHFDKSQHNALLESEFSGALASLGLVYSETEMHEVFQAASEGQVSV
SFEQFITFMVEVTEDQLSAEQVLQSFAEVADGKMYVTELDLQNSLIPEPMIDQLKDTMPK
TADGFDYIAYMERLTL
Download sequence
Identical sequences A0A1D8NMJ0 Q6C2I6
4952.Q6C2I6 gnl|GLV|YALI0F07601g XP_505126.1.88470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]