SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4952.Q6CGM2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4952.Q6CGM2
Domain Number 1 Region: 150-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.2e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 296-368
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000745
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 3 Region: 62-129
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000332
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4952.Q6CGM2
Sequence length 385
Comment (Yarrowia lipolytica)
Sequence
MFVRDESVADSNENSVANHLNMTHDFGHVHVDHDHDHDNVDPAGNFASFANDPIGNPATL
GDDTTQLVLRALVSTKEAGVIIGKDGATVAGLRDAAKVKAGVTKSVAGIPDRILSVAGTA
AGVSRAIGLAAAALVAHPPSGYVLNLVPPGPQGTTTVRLLIPHQRMGSILGKGGVRIKAI
QAKYGVRIVASKHRLPHSSERIVEIQGEPLALQTAVYTVVQCLLEEKDKSILVAYYNPRS
LEGSMTLREDPEDKEYVSFAGYRGRHQDGGSDTDTDREATVSDHGGDAEALSSSDACVQS
TIIPASFAGYIIGRRGDNIRELRKRSGAAISISSEYERERTLLMRGSEAAVALAMSMLQQ
QMDEERERRAQVGSEEGNNGFCSDV
Download sequence
Identical sequences A0A1D8N5A6 Q6CGM2
gnl|GLV|YALI0A18161g XP_500190.1.88470 4952.Q6CGM2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]