SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4959.B5RT67 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4959.B5RT67
Domain Number 1 Region: 805-911
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000633
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 2 Region: 724-806
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 647-729
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 
Domain Number 4 Region: 969-1043
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000278
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 5 Region: 164-263
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 
Domain Number 6 Region: 1164-1219
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000424
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 7 Region: 889-967
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000123
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 8 Region: 314-390
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000475
Family Eukaryotic type KH-domain (KH-domain type I) 0.007
Further Details:      
 
Weak hits

Sequence:  4959.B5RT67
Domain Number - Region: 566-640
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00453
Family Eukaryotic type KH-domain (KH-domain type I) 0.0088
Further Details:      
 
Domain Number - Region: 283-329
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00491
Family Eukaryotic type KH-domain (KH-domain type I) 0.0071
Further Details:      
 
Domain Number - Region: 524-563
Classification Level Classification E-value
Superfamily Hypothetical protein MG354 0.0745
Family Hypothetical protein MG354 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4959.B5RT67
Sequence length 1220
Comment (Debaryomyces hansenii)
Sequence
MSTPAEIIAARVNGISNSNEEHEILNAESPIQVSSDSDDLNSFNESEASLTTSAPSISDD
SAFPTLGGKKSSISSSTPSWGPAMKAPKSVSASPSAAKATSAVGTGKFKGSTIQEAFSLD
SEDQLNVARPEFIKILTAVKADTKTNIECTTSQHTKKRTFLITGKPEEVKLAKRLVIKKL
TKPVKITFNVPGKVRSKIIGPQGRTLKPIIQSNEVKIDIGHPEESQEAEAEDDIFAQTVR
VTVEGDVEGCKHAKASILAIVKEETKTLSTRLAIEDIVKPFAGKVIDPIVQRYSDLDISV
PDYKSSNSNIHIVGDRESVIEAKEQIKDALDALSGKILVEEVPIPKTKHQFLPIDSILEE
NNVLIKLPGHDETNVKFIGEKKNIPAAQENARKTTSQYKVEVLDMSKAHKGNMNHVKAVA
SLLVKNGTFKSISEANDVVINAPSKKQLEDKEATTIPIEIVLKNDDTEKAKVTRKAIVSV
VNKISPDSTKVINDVAEFLIRKVPSTIDEIAAQNNVSYVILGNTITLFSKVEDESDDFDF
VDSSNSSDSFAPIDNSLNKLRELSSDLHSVVLKVPFNQQTEISGPRDTTLKAILSGVEAN
SVVVKLHSNASGKSADEIYIHGIKSAVSTVQNDIEATLKDAETYKEQGGFKTSFEVPSSV
LSRLIGKNGSNMISLREQFGVKIDVSDDGKQEGTKDKNDKTEIVISGNKRNAEDCKASIA
QFSKKWADETLARLRIESQYHRRMIGPSGVYINRLQDKYDVKIRFPSVDNVPSTFADAPK
SKDEVTIKGPSKGVAKAEEELKELYQFEKENGFKETMQVPTKAIARVIGKSGETINDIAD
GCGIEYKFNRDNDNESEVGYTEVELTGSRSALKEATKKIQEIIDEAENFTTVTINVDSKY
HRELIGQGGSVMKEIIANAGGEDVSRAKYFRLLSIPNEGSGSDEVTSQGDKTIVNKVIEQ
VKKIIAAKEASVIVEYDLPKEKHRLIVGQAGSIRHALQDEFKAQIDIPRPSDESTTIKLV
GLPEQIEGLKAKIESLTKDDWNVSIDIPENYHALVSERGAIFKKLQADYNVQVQHGNLTR
KASKLSSAPIPTPSESAYPSEDEKAKFTVVPNDQVSGGSDVIPWRLKGDEKDTKKAATLI
QERLENAKNATSIGWFYSSNPSSFYKVVGSQGSKINDIRKKSSTFITVPRANDKNANFIY
LVGSESNLDIAKEAIEALLK
Download sequence
Identical sequences B5RT67
4959.B5RT67 XP_002770162.1.41535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]