SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4959.B5RTG3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4959.B5RTG3
Domain Number 1 Region: 901-1039,1070-1276
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-34
Family p120GAP domain-like 0.0045
Further Details:      
 
Domain Number 2 Region: 182-323
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-30
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 1506-1608
Classification Level Classification E-value
Superfamily RGC domain-like 1.01e-22
Family RGC domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4959.B5RTG3
Sequence length 1612
Comment (Debaryomyces hansenii)
Sequence
MTSPIKSNVALRYLASINDSGVDTPNRLPLQPTLKYNLTPSRTKKDQTDEQDLDKLAKQL
NINPTTSPSKTALLRSRFESPSVTVSSFKSPSSKSNTSATSSRSGSPVRRTPLDGDEGKT
IASAFRKDAFDSSSTKGHLETPSSFKDNNKLSPLKQQINTPSPSHTPFLSSPSNNTSKDS
PGNEYLCRIMALKNWLETVLQESITQKPAELISYIRNGIHLAKLANVILNSQKTVFTNDS
KLQFRHTENINRFFQLLDYLNVPDLFRFELTDLYDAKNVPKVWFCLHAMSYMLNKMEPSY
PQVENLVHRVDFSGEEIRTANRALVGAGLPNFSSADTSDSSPLKAGQSSYMNRALASSNK
LQPLKGFKAEKKIDNENPFMERSVANDDHLVKPTNSSYSPLKKNVEHYNSSRPSTLNFHS
STLSYDIDYKSSKYYTPEVEEHIENVKKLQALARGANFRYRMFVDRIMLKSFGDELTYFV
SIMRGNMSRNKTVHKHRDELLMYKYELVKLQSIIRGRLSKSSNNYDFSGCGNSSINLQST
IRGYLERKRFNTVKSAVSGSTSSVIDLQSVMKAKLIRPKATVLMKHKDSIEPSILGFQAI
CRGCLFKRYSKSSRIQSLSNGGGMVKLQSLIRGQVIRNDIHRKRNIISRSLSNLCDLQSI
ARGGISRTRLCNNVLITLIYEDSVLNTLYARVRGNNARKEIQRKKDILKENESRTILPIQ
SIFRGILCRFQREIRLEDLYFDIDNIIDLQSIIRGKAIRNEITSIETYYHINSDKVIRAQ
AIIKSNFTQRAYKSLINMKNPPLAVIQRFAYLLTDNDMDYQEEMELSDMKDKIIGKSKNN
EDLELQIENSDIKLSLLDKNKITVEEFIKHKNKYKTYKPAANNAVNLQNLAKLNKSSRER
IDLYQTMFYFLQTKPVYFIRLYNSMPIASKDSKFNKDLQYYITSMFPIKDSSINHHSREE
FFLVKFISSMMNNDMEYNCRTISDITKCQECFWIDYLLQFNNHTYQRLHLKGIMGKSISH
IIDNDELDFESDPSEIYSDVIKREIKINGSSDKPEHVTSQVAIKNTDVSDRFVKNLMHLR
EFSTEVFNVLEKSIERIPIHIRLLSNNAYRLSQVHFPEKSEQQHLAVAGVVFIKHYISAI
LQYPENFGYLAKSPFNASLYNAKAKDNLKHLSRVMLQVFSMKPFSDNYLKPLNDYVISMN
GMIKKMVSRLIDVKSIEDEYELNDYDDIVTHERPKLSMKVSDMIMIEKIVSQNVDVMAPS
SDDQLCDITSKLEDVINSADDFVTLTELGIVTLNLNPTTKEDSLADSKVLSLISQAKRCI
LYIIRIQEGSGLLELLISGIKPQHEAKFKEIVSVERKEIEEASTNVKKRPYYKTSLGNLS
SLTYHELKKMALEIILKLESMGVLTRKNAFQEILNQIAIDIKTKHSQRVNRKAQLEIASK
TQKKLLDKEKFLTKQLFDYNQHIDNVLSELQSKSKDKKLFNIIPVFSKQYFYHRELKKSN
RLPKFGSYKYSAKKLIDQEILIDFGGLMSQRYSSSSKLDFMFSCHEVGKFTIEAATGSVN
IPGAYNSVTIDQLLNLQYENKEKFELFDGMVIFDTHNLTGFIFRKFYDLRRD
Download sequence
Identical sequences B5RTG3
4959.B5RTG3 XP_002770293.1.41535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]